Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3812158..3812809 | Replicon | chromosome |
| Accession | NZ_LR134270 | ||
| Organism | Escherichia marmotae strain NCTC8196 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | EL146_RS18615 | Protein ID | WP_126511403.1 |
| Coordinates | 3812158..3812562 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A7U9H610 |
| Locus tag | EL146_RS18620 | Protein ID | WP_000354045.1 |
| Coordinates | 3812543..3812809 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL146_RS18595 | 3808122..3809855 | - | 1734 | WP_000813173.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| EL146_RS18600 | 3809861..3810571 | - | 711 | WP_000715232.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EL146_RS18605 | 3810596..3811492 | - | 897 | WP_000806649.1 | site-specific tyrosine recombinase XerD | - |
| EL146_RS18610 | 3811603..3812124 | + | 522 | WP_016249162.1 | flavodoxin FldB | - |
| EL146_RS18615 | 3812158..3812562 | - | 405 | WP_126511403.1 | protein YgfX | Toxin |
| EL146_RS18620 | 3812543..3812809 | - | 267 | WP_000354045.1 | FAD assembly factor SdhE | Antitoxin |
| EL146_RS18625 | 3813062..3814042 | + | 981 | WP_000886070.1 | tRNA-modifying protein YgfZ | - |
| EL146_RS18630 | 3814189..3814848 | - | 660 | WP_001517030.1 | hemolysin III family protein | - |
| EL146_RS18635 | 3815011..3815322 | - | 312 | WP_001182960.1 | N(4)-acetylcytidine aminohydrolase | - |
| EL146_RS18640 | 3815367..3816800 | + | 1434 | WP_001517031.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 16103.06 Da Isoelectric Point: 11.5202
>T287424 WP_126511403.1 NZ_LR134270:c3812562-3812158 [Escherichia marmotae]
VVLWQSELRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWLVLLSLVVFDCVRSQRRINSRQGEIRLLMDWRLRWQGQ
EWSIVKTPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRIVLQQEIR
VVLWQSELRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWLVLLSLVVFDCVRSQRRINSRQGEIRLLMDWRLRWQGQ
EWSIVKTPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRIVLQQEIR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|