Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2503248..2503886 | Replicon | chromosome |
Accession | NZ_LR134270 | ||
Organism | Escherichia marmotae strain NCTC8196 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
Locus tag | EL146_RS12265 | Protein ID | WP_000813795.1 |
Coordinates | 2503710..2503886 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL146_RS12260 | Protein ID | WP_077627724.1 |
Coordinates | 2503248..2503664 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL146_RS12240 | 2498403..2499344 | - | 942 | WP_001516417.1 | ABC transporter permease | - |
EL146_RS12245 | 2499345..2500358 | - | 1014 | WP_016248715.1 | ABC transporter ATP-binding protein | - |
EL146_RS12250 | 2500376..2501521 | - | 1146 | WP_000047463.1 | ABC transporter substrate-binding protein | - |
EL146_RS12255 | 2501760..2503169 | - | 1410 | WP_016248716.1 | PLP-dependent aminotransferase family protein | - |
EL146_RS12260 | 2503248..2503664 | - | 417 | WP_077627724.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL146_RS12265 | 2503710..2503886 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL146_RS12270 | 2504108..2504338 | + | 231 | WP_000494240.1 | DUF2554 family protein | - |
EL146_RS12275 | 2504432..2506393 | - | 1962 | WP_024193578.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL146_RS12280 | 2506466..2507002 | - | 537 | WP_001516421.1 | XRE family transcriptional regulator | - |
EL146_RS12285 | 2507055..2508266 | + | 1212 | WP_071990339.1 | benzoate/H(+) symporter BenE family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T287422 WP_000813795.1 NZ_LR134270:c2503886-2503710 [Escherichia marmotae]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15250.62 Da Isoelectric Point: 4.5908
>AT287422 WP_077627724.1 NZ_LR134270:c2503664-2503248 [Escherichia marmotae]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|