Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 1906555..1907033 Replicon chromosome
Accession NZ_LR134270
Organism Escherichia marmotae strain NCTC8196

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A7D8WGY6
Locus tag EL146_RS09010 Protein ID WP_000936798.1
Coordinates 1906555..1906842 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A7D8X397
Locus tag EL146_RS09015 Protein ID WP_024207685.1
Coordinates 1906842..1907033 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL146_RS08970 1901694..1901945 - 252 WP_021564129.1 DUF4224 domain-containing protein -
EL146_RS08975 1902012..1904468 - 2457 WP_126511178.1 exonuclease -
EL146_RS08980 1904559..1904750 - 192 WP_033873261.1 DUF1482 family protein -
EL146_RS08985 1904747..1904935 - 189 WP_001541619.1 hypothetical protein -
EL146_RS08990 1904964..1905245 + 282 WP_126511180.1 hypothetical protein -
EL146_RS08995 1905235..1905609 - 375 WP_097314167.1 hypothetical protein -
EL146_RS09000 1905632..1905850 - 219 WP_032176169.1 hypothetical protein -
EL146_RS23755 1905922..1906221 - 300 WP_050582285.1 hypothetical protein -
EL146_RS09010 1906555..1906842 - 288 WP_000936798.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL146_RS09015 1906842..1907033 - 192 WP_024207685.1 hypothetical protein Antitoxin
EL146_RS09020 1907061..1907462 - 402 WP_001329851.1 helix-turn-helix domain-containing protein -
EL146_RS09025 1907572..1907844 + 273 WP_024207686.1 helix-turn-helix domain-containing protein -
EL146_RS09030 1907828..1908349 + 522 WP_001541649.1 hypothetical protein -
EL146_RS09035 1908330..1909295 + 966 WP_123017437.1 hypothetical protein -
EL146_RS09040 1909336..1909755 + 420 WP_126511181.1 DUF977 family protein -
EL146_RS09045 1909752..1910051 + 300 WP_126511183.1 DUF4406 domain-containing protein -
EL146_RS09050 1910038..1910706 + 669 WP_126511189.1 ead/Ea22-like family protein -
EL146_RS09055 1910708..1911064 + 357 WP_186334788.1 hypothetical protein -
EL146_RS09060 1911291..1911677 + 387 WP_186334794.1 antitermination protein -
EL146_RS23760 1911788..1911973 + 186 WP_186334789.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1899638..1942307 42669
- inside Prophage - - 1899217..1941039 41822


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10899.83 Da        Isoelectric Point: 10.1360

>T287416 WP_000936798.1 NZ_LR134270:c1906842-1906555 [Escherichia marmotae]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7017.77 Da        Isoelectric Point: 4.0270

>AT287416 WP_024207685.1 NZ_LR134270:c1907033-1906842 [Escherichia marmotae]
MSTALSPIVSEFETTEQENSYNEWLRAKVASSLADPRPSIPHDEVMAEIENLIAQIAVTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D8WGY6

Antitoxin

Source ID Structure
AlphaFold DB A0A7D8X397

References