Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 1906555..1907033 | Replicon | chromosome |
| Accession | NZ_LR134270 | ||
| Organism | Escherichia marmotae strain NCTC8196 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A7D8WGY6 |
| Locus tag | EL146_RS09010 | Protein ID | WP_000936798.1 |
| Coordinates | 1906555..1906842 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | A0A7D8X397 |
| Locus tag | EL146_RS09015 | Protein ID | WP_024207685.1 |
| Coordinates | 1906842..1907033 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL146_RS08970 | 1901694..1901945 | - | 252 | WP_021564129.1 | DUF4224 domain-containing protein | - |
| EL146_RS08975 | 1902012..1904468 | - | 2457 | WP_126511178.1 | exonuclease | - |
| EL146_RS08980 | 1904559..1904750 | - | 192 | WP_033873261.1 | DUF1482 family protein | - |
| EL146_RS08985 | 1904747..1904935 | - | 189 | WP_001541619.1 | hypothetical protein | - |
| EL146_RS08990 | 1904964..1905245 | + | 282 | WP_126511180.1 | hypothetical protein | - |
| EL146_RS08995 | 1905235..1905609 | - | 375 | WP_097314167.1 | hypothetical protein | - |
| EL146_RS09000 | 1905632..1905850 | - | 219 | WP_032176169.1 | hypothetical protein | - |
| EL146_RS23755 | 1905922..1906221 | - | 300 | WP_050582285.1 | hypothetical protein | - |
| EL146_RS09010 | 1906555..1906842 | - | 288 | WP_000936798.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL146_RS09015 | 1906842..1907033 | - | 192 | WP_024207685.1 | hypothetical protein | Antitoxin |
| EL146_RS09020 | 1907061..1907462 | - | 402 | WP_001329851.1 | helix-turn-helix domain-containing protein | - |
| EL146_RS09025 | 1907572..1907844 | + | 273 | WP_024207686.1 | helix-turn-helix domain-containing protein | - |
| EL146_RS09030 | 1907828..1908349 | + | 522 | WP_001541649.1 | hypothetical protein | - |
| EL146_RS09035 | 1908330..1909295 | + | 966 | WP_123017437.1 | hypothetical protein | - |
| EL146_RS09040 | 1909336..1909755 | + | 420 | WP_126511181.1 | DUF977 family protein | - |
| EL146_RS09045 | 1909752..1910051 | + | 300 | WP_126511183.1 | DUF4406 domain-containing protein | - |
| EL146_RS09050 | 1910038..1910706 | + | 669 | WP_126511189.1 | ead/Ea22-like family protein | - |
| EL146_RS09055 | 1910708..1911064 | + | 357 | WP_186334788.1 | hypothetical protein | - |
| EL146_RS09060 | 1911291..1911677 | + | 387 | WP_186334794.1 | antitermination protein | - |
| EL146_RS23760 | 1911788..1911973 | + | 186 | WP_186334789.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1899638..1942307 | 42669 | |
| - | inside | Prophage | - | - | 1899217..1941039 | 41822 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10899.83 Da Isoelectric Point: 10.1360
>T287416 WP_000936798.1 NZ_LR134270:c1906842-1906555 [Escherichia marmotae]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D8WGY6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D8X397 |