Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1292849..1293467 | Replicon | chromosome |
| Accession | NZ_LR134270 | ||
| Organism | Escherichia marmotae strain NCTC8196 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | EL146_RS06230 | Protein ID | WP_001280991.1 |
| Coordinates | 1292849..1293067 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A7U9DNY0 |
| Locus tag | EL146_RS06235 | Protein ID | WP_000344801.1 |
| Coordinates | 1293072..1293467 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL146_RS06195 | 1288143..1288715 | + | 573 | WP_016248421.1 | YbaY family lipoprotein | - |
| EL146_RS06200 | 1288746..1289057 | - | 312 | WP_000409903.1 | MGMT family protein | - |
| EL146_RS06210 | 1289437..1289790 | + | 354 | WP_000878149.1 | DUF1428 domain-containing protein | - |
| EL146_RS06215 | 1289827..1291377 | - | 1551 | WP_001515896.1 | EAL domain-containing protein | - |
| EL146_RS06220 | 1291541..1292011 | - | 471 | WP_010379081.1 | YlaC family protein | - |
| EL146_RS06225 | 1292126..1292677 | - | 552 | WP_000102537.1 | maltose O-acetyltransferase | - |
| EL146_RS06230 | 1292849..1293067 | - | 219 | WP_001280991.1 | hemolysin expression modulator Hha | Toxin |
| EL146_RS06235 | 1293072..1293467 | - | 396 | WP_000344801.1 | Hha toxicity modulator TomB | Antitoxin |
| EL146_RS06240 | 1294024..1297172 | - | 3149 | Protein_1186 | efflux RND transporter permease AcrB | - |
| EL146_RS06245 | 1297195..1298388 | - | 1194 | WP_001515899.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T287415 WP_001280991.1 NZ_LR134270:c1293067-1292849 [Escherichia marmotae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 15393.22 Da Isoelectric Point: 4.9228
>AT287415 WP_000344801.1 NZ_LR134270:c1293467-1293072 [Escherichia marmotae]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSCSNYYNHG
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSCSNYYNHG
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|