Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 730805..731381 | Replicon | chromosome |
| Accession | NZ_LR134270 | ||
| Organism | Escherichia marmotae strain NCTC8196 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A7U9H5P0 |
| Locus tag | EL146_RS03550 | Protein ID | WP_016249550.1 |
| Coordinates | 730805..731092 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A7U9DAW4 |
| Locus tag | EL146_RS03555 | Protein ID | WP_000063150.1 |
| Coordinates | 731079..731381 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL146_RS03535 | 726384..727769 | - | 1386 | WP_016249547.1 | restriction endonuclease subunit S | - |
| EL146_RS03540 | 727756..729378 | - | 1623 | WP_016249548.1 | type I restriction-modification system subunit M | - |
| EL146_RS03545 | 729442..730608 | - | 1167 | WP_016249549.1 | restriction endonuclease | - |
| EL146_RS03550 | 730805..731092 | + | 288 | WP_016249550.1 | BrnT family toxin | Toxin |
| EL146_RS03555 | 731079..731381 | + | 303 | WP_000063150.1 | BrnA antitoxin family protein | Antitoxin |
| EL146_RS03560 | 731415..732371 | - | 957 | WP_001297640.1 | GTPase | - |
| EL146_RS03565 | 732382..732585 | - | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| EL146_RS03570 | 732705..734855 | - | 2151 | WP_016249551.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11082.59 Da Isoelectric Point: 8.6424
>T287413 WP_016249550.1 NZ_LR134270:730805-731092 [Escherichia marmotae]
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRVGNGEYRWQTIGLVHGIVVILVAHIIRFESGNEIIRIIS
ARKADRKERSRYEHG
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRVGNGEYRWQTIGLVHGIVVILVAHIIRFESGNEIIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H5P0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9DAW4 |