Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1908377..1908839 Replicon chromosome
Accession NZ_LR134269
Organism Staphylococcus warneri strain NCTC11044

Toxin (Protein)


Gene name TsaT Uniprot ID A0A2V3ZEQ2
Locus tag EL082_RS09330 Protein ID WP_002465948.1
Coordinates 1908654..1908839 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A364UQZ8
Locus tag EL082_RS09325 Protein ID WP_015365250.1
Coordinates 1908377..1908634 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL082_RS09285 1903585..1903908 + 324 WP_015365247.1 thioredoxin family protein -
EL082_RS09290 1904020..1904559 - 540 WP_002465937.1 nitroreductase -
EL082_RS09295 1904637..1905353 - 717 WP_002465941.1 type I 3-dehydroquinate dehydratase -
EL082_RS09300 1905529..1905951 + 423 WP_002450862.1 organic hydroperoxide resistance protein -
EL082_RS09305 1906229..1906723 + 495 WP_002465942.1 GNAT family N-acetyltransferase -
EL082_RS09310 1906856..1907446 - 591 WP_002465945.1 histidine phosphatase family protein -
EL082_RS09315 1907655..1907888 + 234 WP_002450865.1 hypothetical protein -
EL082_RS09320 1907880..1908083 - 204 WP_015365249.1 sterile alpha motif-like domain-containing protein -
EL082_RS09325 1908377..1908634 + 258 WP_015365250.1 hypothetical protein Antitoxin
EL082_RS09330 1908654..1908839 + 186 WP_002465948.1 hypothetical protein Toxin
EL082_RS09335 1908940..1909521 + 582 WP_015365251.1 hypothetical protein -
EL082_RS09340 1909581..1909814 - 234 WP_002450870.1 hypothetical protein -
EL082_RS09345 1910079..1910831 + 753 WP_002465946.1 poly-gamma-glutamate hydrolase family protein -
EL082_RS09350 1910922..1911206 + 285 WP_002465939.1 hypothetical protein -
EL082_RS09355 1911284..1911499 + 216 WP_002465949.1 hypothetical protein -
EL082_RS09360 1911964..1912203 + 240 WP_002465943.1 hypothetical protein -
EL082_RS09365 1912432..1912665 + 234 WP_015365252.1 hypothetical protein -
EL082_RS09370 1912840..1913040 - 201 WP_103286258.1 cold-shock protein -
EL082_RS09375 1913361..1913726 - 366 WP_002466279.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6977.68 Da        Isoelectric Point: 10.1605

>T287411 WP_002465948.1 NZ_LR134269:1908654-1908839 [Staphylococcus warneri]
MSLHFTILFWLSLIFIVAGAIILAIMLKTKKESKKESYLGFTIVFFIFGLAMLIYTLLFGL

Download         Length: 186 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9908.17 Da        Isoelectric Point: 4.5910

>AT287411 WP_015365250.1 NZ_LR134269:1908377-1908634 [Staphylococcus warneri]
MKLYIIHAINIILTILFIIFNVIITYNANLDDTLWLVPGLIVCGLIMMISFAIAITKKDLLSEVLFFINIILTLYYIYPI
FYDFL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2V3ZEQ2

Antitoxin

Source ID Structure
AlphaFold DB A0A364UQZ8

References