Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 814900..815424 | Replicon | chromosome |
| Accession | NZ_LR134267 | ||
| Organism | Staphylococcus pseudintermedius strain NCTC5661 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2A4EDC7 |
| Locus tag | EL085_RS03575 | Protein ID | WP_014613379.1 |
| Coordinates | 815071..815424 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A166MM16 |
| Locus tag | EL085_RS03570 | Protein ID | WP_014613378.1 |
| Coordinates | 814900..815070 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL085_RS03545 | 810789..811262 | + | 474 | WP_014613373.1 | PH domain-containing protein | - |
| EL085_RS03550 | 811255..812784 | + | 1530 | WP_014613374.1 | PH domain-containing protein | - |
| EL085_RS03555 | 812768..813286 | + | 519 | WP_014613375.1 | PH domain-containing protein | - |
| EL085_RS03560 | 813283..813633 | + | 351 | WP_014613376.1 | holo-ACP synthase | - |
| EL085_RS03565 | 813667..814815 | + | 1149 | WP_126510888.1 | alanine racemase | - |
| EL085_RS03570 | 814900..815070 | + | 171 | WP_014613378.1 | hypothetical protein | Antitoxin |
| EL085_RS03575 | 815071..815424 | + | 354 | WP_014613379.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL085_RS03580 | 815482..816486 | + | 1005 | WP_014613380.1 | PP2C family protein-serine/threonine phosphatase | - |
| EL085_RS03585 | 816565..816891 | + | 327 | WP_014613381.1 | anti-sigma factor antagonist | - |
| EL085_RS03590 | 816891..817370 | + | 480 | WP_031253870.1 | anti-sigma B factor RsbW | - |
| EL085_RS03595 | 817345..818115 | + | 771 | WP_014613383.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13130.36 Da Isoelectric Point: 10.4439
>T287405 WP_014613379.1 NZ_LR134267:815071-815424 [Staphylococcus pseudintermedius]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A4EDC7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A166MM16 |