Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1703985..1704794 | Replicon | chromosome |
| Accession | NZ_LR134264 | ||
| Organism | Staphylococcus simulans strain NCTC7944 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | EL095_RS08235 | Protein ID | WP_126498138.1 |
| Coordinates | 1704330..1704794 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | EL095_RS08230 | Protein ID | WP_105996454.1 |
| Coordinates | 1703985..1704317 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL095_RS08170 | 1699265..1699750 | - | 486 | WP_126498133.1 | siphovirus Gp157 family protein | - |
| EL095_RS08175 | 1699753..1700019 | - | 267 | WP_060803545.1 | DUF1108 family protein | - |
| EL095_RS08180 | 1700123..1700338 | - | 216 | WP_126498134.1 | hypothetical protein | - |
| EL095_RS08185 | 1700351..1700653 | - | 303 | WP_015978144.1 | DUF771 domain-containing protein | - |
| EL095_RS08190 | 1700700..1700930 | + | 231 | WP_015978143.1 | hypothetical protein | - |
| EL095_RS08195 | 1700890..1701030 | - | 141 | WP_015978164.1 | hypothetical protein | - |
| EL095_RS08200 | 1701043..1701279 | - | 237 | WP_015978153.1 | hypothetical protein | - |
| EL095_RS08205 | 1701280..1702053 | - | 774 | WP_126498135.1 | phage antirepressor KilAC domain-containing protein | - |
| EL095_RS08210 | 1702105..1702575 | + | 471 | WP_126498136.1 | hypothetical protein | - |
| EL095_RS08215 | 1702538..1702771 | - | 234 | WP_070724726.1 | hypothetical protein | - |
| EL095_RS08220 | 1702786..1703538 | - | 753 | WP_126498137.1 | phage antirepressor KilAC domain-containing protein | - |
| EL095_RS08225 | 1703553..1703792 | - | 240 | WP_106421060.1 | helix-turn-helix domain-containing protein | - |
| EL095_RS08230 | 1703985..1704317 | + | 333 | WP_105996454.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL095_RS08235 | 1704330..1704794 | + | 465 | WP_126498138.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| EL095_RS08240 | 1704809..1705348 | + | 540 | Protein_1595 | hypothetical protein | - |
| EL095_RS08245 | 1705779..1706807 | + | 1029 | WP_126498139.1 | site-specific integrase | - |
| EL095_RS08250 | 1706819..1707001 | - | 183 | WP_031262694.1 | RNA chaperone Hfq | - |
| EL095_RS08255 | 1706995..1707957 | - | 963 | WP_126498140.1 | tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA | - |
| EL095_RS08260 | 1707959..1708894 | - | 936 | WP_126498141.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1587436..1779895 | 192459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18236.47 Da Isoelectric Point: 5.9325
>T287399 WP_126498138.1 NZ_LR134264:1704330-1704794 [Staphylococcus simulans]
MGVYEDLCIANDWVEIEETDRLPSFQPGFYRNGKIYIKSSLSETRKAEVLYEELAHHKLTYGNILDESSFNNRKFENYAR
RHGYENAISLTKIIDAYKYGVSSLHEFAEYVQLSEEYVYTVLQHYKNKFGLSTCHNGYLVRFEPLQVFKYIEKE
MGVYEDLCIANDWVEIEETDRLPSFQPGFYRNGKIYIKSSLSETRKAEVLYEELAHHKLTYGNILDESSFNNRKFENYAR
RHGYENAISLTKIIDAYKYGVSSLHEFAEYVQLSEEYVYTVLQHYKNKFGLSTCHNGYLVRFEPLQVFKYIEKE
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|