Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1703985..1704794 Replicon chromosome
Accession NZ_LR134264
Organism Staphylococcus simulans strain NCTC7944

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag EL095_RS08235 Protein ID WP_126498138.1
Coordinates 1704330..1704794 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag EL095_RS08230 Protein ID WP_105996454.1
Coordinates 1703985..1704317 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL095_RS08170 1699265..1699750 - 486 WP_126498133.1 siphovirus Gp157 family protein -
EL095_RS08175 1699753..1700019 - 267 WP_060803545.1 DUF1108 family protein -
EL095_RS08180 1700123..1700338 - 216 WP_126498134.1 hypothetical protein -
EL095_RS08185 1700351..1700653 - 303 WP_015978144.1 DUF771 domain-containing protein -
EL095_RS08190 1700700..1700930 + 231 WP_015978143.1 hypothetical protein -
EL095_RS08195 1700890..1701030 - 141 WP_015978164.1 hypothetical protein -
EL095_RS08200 1701043..1701279 - 237 WP_015978153.1 hypothetical protein -
EL095_RS08205 1701280..1702053 - 774 WP_126498135.1 phage antirepressor KilAC domain-containing protein -
EL095_RS08210 1702105..1702575 + 471 WP_126498136.1 hypothetical protein -
EL095_RS08215 1702538..1702771 - 234 WP_070724726.1 hypothetical protein -
EL095_RS08220 1702786..1703538 - 753 WP_126498137.1 phage antirepressor KilAC domain-containing protein -
EL095_RS08225 1703553..1703792 - 240 WP_106421060.1 helix-turn-helix domain-containing protein -
EL095_RS08230 1703985..1704317 + 333 WP_105996454.1 helix-turn-helix domain-containing protein Antitoxin
EL095_RS08235 1704330..1704794 + 465 WP_126498138.1 ImmA/IrrE family metallo-endopeptidase Toxin
EL095_RS08240 1704809..1705348 + 540 Protein_1595 hypothetical protein -
EL095_RS08245 1705779..1706807 + 1029 WP_126498139.1 site-specific integrase -
EL095_RS08250 1706819..1707001 - 183 WP_031262694.1 RNA chaperone Hfq -
EL095_RS08255 1706995..1707957 - 963 WP_126498140.1 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA -
EL095_RS08260 1707959..1708894 - 936 WP_126498141.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1587436..1779895 192459


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(31-118)

Antitoxin

Cro/C1-type helix-turn-helix domain

(10-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18236.47 Da        Isoelectric Point: 5.9325

>T287399 WP_126498138.1 NZ_LR134264:1704330-1704794 [Staphylococcus simulans]
MGVYEDLCIANDWVEIEETDRLPSFQPGFYRNGKIYIKSSLSETRKAEVLYEELAHHKLTYGNILDESSFNNRKFENYAR
RHGYENAISLTKIIDAYKYGVSSLHEFAEYVQLSEEYVYTVLQHYKNKFGLSTCHNGYLVRFEPLQVFKYIEKE

Download         Length: 465 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12869.51 Da        Isoelectric Point: 4.7176

>AT287399 WP_105996454.1 NZ_LR134264:1703985-1704317 [Staphylococcus simulans]
MRTNDEIITIIKTTLKEQNMSLSELARRVGMAKSAVSRYLNLTREFPLNRAEDFAKALHISTEYLLGFTESEQKEQEQDT
MAAHFDKEGLTEEEIEEVNKFIEWVKNRDK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References