Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 879228..879752 | Replicon | chromosome |
Accession | NZ_LR134263 | ||
Organism | Staphylococcus delphini strain NCTC12225 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2A4EDC7 |
Locus tag | EL101_RS03965 | Protein ID | WP_014613379.1 |
Coordinates | 879399..879752 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A166MM16 |
Locus tag | EL101_RS03960 | Protein ID | WP_014613378.1 |
Coordinates | 879228..879398 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL101_RS03935 | 875118..875591 | + | 474 | WP_096597952.1 | PH domain-containing protein | - |
EL101_RS03940 | 875584..877113 | + | 1530 | WP_096597950.1 | PH domain-containing protein | - |
EL101_RS03945 | 877097..877615 | + | 519 | WP_096597948.1 | PH domain-containing protein | - |
EL101_RS03950 | 877612..877962 | + | 351 | WP_096597946.1 | holo-ACP synthase | - |
EL101_RS03955 | 877996..879144 | + | 1149 | WP_096598058.1 | alanine racemase | - |
EL101_RS03960 | 879228..879398 | + | 171 | WP_014613378.1 | hypothetical protein | Antitoxin |
EL101_RS03965 | 879399..879752 | + | 354 | WP_014613379.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL101_RS03970 | 879810..880814 | + | 1005 | WP_019165832.1 | PP2C family protein-serine/threonine phosphatase | - |
EL101_RS03975 | 880893..881219 | + | 327 | WP_096597944.1 | anti-sigma factor antagonist | - |
EL101_RS03980 | 881219..881698 | + | 480 | WP_026067010.1 | anti-sigma B factor RsbW | - |
EL101_RS03985 | 881673..882443 | + | 771 | WP_096597942.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13130.36 Da Isoelectric Point: 10.4439
>T287395 WP_014613379.1 NZ_LR134263:879399-879752 [Staphylococcus delphini]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A4EDC7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A166MM16 |