Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3933951..3934765 | Replicon | chromosome |
Accession | NZ_LR134248 | ||
Organism | Escherichia coli strain NCTC10537 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | EL141_RS19130 | Protein ID | WP_001054376.1 |
Coordinates | 3933951..3934208 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | EL141_RS19135 | Protein ID | WP_001309181.1 |
Coordinates | 3934220..3934765 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL141_RS19110 | 3929239..3930345 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
EL141_RS19115 | 3930410..3931390 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EL141_RS19120 | 3931973..3933213 | - | 1241 | Protein_3719 | helicase YjhR | - |
EL141_RS19125 | 3933329..3933574 | + | 246 | Protein_3720 | GNAT family N-acetyltransferase | - |
EL141_RS19130 | 3933951..3934208 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
EL141_RS19135 | 3934220..3934765 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
EL141_RS19140 | 3934821..3935567 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
EL141_RS19145 | 3935736..3935954 | + | 219 | Protein_3724 | hypothetical protein | - |
EL141_RS22525 | 3935992..3936108 | + | 117 | Protein_3725 | VOC family protein | - |
EL141_RS19150 | 3936353..3937474 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
EL141_RS19155 | 3937471..3937749 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EL141_RS19160 | 3937761..3939074 | + | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | fimE / fimB | 3924595..3969723 | 45128 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T287392 WP_001054376.1 NZ_LR134248:3933951-3934208 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT287392 WP_001309181.1 NZ_LR134248:3934220-3934765 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|