Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3400990..3401827 | Replicon | chromosome |
| Accession | NZ_LR134248 | ||
| Organism | Escherichia coli strain NCTC10537 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | A0A140NB16 |
| Locus tag | EL141_RS16640 | Protein ID | WP_000227786.1 |
| Coordinates | 3401285..3401827 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | EL141_RS16635 | Protein ID | WP_001297137.1 |
| Coordinates | 3400990..3401301 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL141_RS16610 | 3396010..3396957 | + | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
| EL141_RS16615 | 3396979..3398970 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| EL141_RS16620 | 3398960..3399574 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| EL141_RS16625 | 3399574..3399903 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| EL141_RS16630 | 3399915..3400805 | + | 891 | WP_000971336.1 | heme o synthase | - |
| EL141_RS16635 | 3400990..3401301 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| EL141_RS16640 | 3401285..3401827 | + | 543 | WP_000227786.1 | GNAT family N-acetyltransferase | Toxin |
| EL141_RS16645 | 3401883..3402818 | - | 936 | WP_001297127.1 | sel1 repeat family protein | - |
| EL141_RS16650 | 3403235..3404599 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| EL141_RS16655 | 3404727..3405218 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| EL141_RS16660 | 3405386..3406297 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19794.98 Da Isoelectric Point: 8.3395
>T287389 WP_000227786.1 NZ_LR134248:3401285-3401827 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140NB16 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y6B3 |