Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 834343..835175 | Replicon | chromosome |
| Accession | NZ_LR134248 | ||
| Organism | Escherichia coli strain NCTC10537 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3P5UBZ5 |
| Locus tag | EL141_RS04040 | Protein ID | WP_001094454.1 |
| Coordinates | 834343..834717 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3G8RJV8 |
| Locus tag | EL141_RS04045 | Protein ID | WP_001320394.1 |
| Coordinates | 834807..835175 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL141_RS04010 | 829456..830604 | - | 1149 | WP_000905931.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| EL141_RS04015 | 830676..831659 | - | 984 | WP_024181915.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| EL141_RS04020 | 832470..832640 | - | 171 | Protein_783 | IS110 family transposase | - |
| EL141_RS04025 | 832983..833552 | - | 570 | WP_001290250.1 | DUF4942 domain-containing protein | - |
| EL141_RS04030 | 833649..833846 | - | 198 | WP_000839276.1 | DUF957 domain-containing protein | - |
| EL141_RS04035 | 833858..834346 | - | 489 | WP_000777545.1 | hypothetical protein | - |
| EL141_RS04040 | 834343..834717 | - | 375 | WP_001094454.1 | TA system toxin CbtA family protein | Toxin |
| EL141_RS04045 | 834807..835175 | - | 369 | WP_001320394.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL141_RS04050 | 835225..835868 | - | 644 | Protein_789 | antitoxin of toxin-antitoxin stability system | - |
| EL141_RS04055 | 835887..836108 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| EL141_RS04060 | 836171..836647 | - | 477 | WP_001347688.1 | RadC family protein | - |
| EL141_RS04065 | 836663..837148 | - | 486 | WP_000849578.1 | antirestriction protein | - |
| EL141_RS04070 | 837203..838021 | - | 819 | WP_001234644.1 | DUF945 domain-containing protein | - |
| EL141_RS04080 | 838121..838354 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
| EL141_RS04085 | 838433..838888 | - | 456 | WP_000581493.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14059.10 Da Isoelectric Point: 9.2447
>T287379 WP_001094454.1 NZ_LR134248:c834717-834343 [Escherichia coli]
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13623.22 Da Isoelectric Point: 6.4783
>AT287379 WP_001320394.1 NZ_LR134248:c835175-834807 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3P5UBZ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G8RJV8 |