Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3901093..3901772 | Replicon | chromosome |
| Accession | NZ_LR134247 | ||
| Organism | Escherichia coli strain NCTC9040 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | EL149_RS19630 | Protein ID | WP_000854680.1 |
| Coordinates | 3901431..3901772 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EWR7 |
| Locus tag | EL149_RS19625 | Protein ID | WP_000070396.1 |
| Coordinates | 3901093..3901410 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL149_RS19580 | 3896531..3897352 | + | 822 | WP_000197387.1 | DUF945 domain-containing protein | - |
| EL149_RS19585 | 3897569..3898270 | + | 702 | WP_000189411.1 | WYL domain-containing protein | - |
| EL149_RS19590 | 3898311..3898547 | + | 237 | WP_001144031.1 | hypothetical protein | - |
| EL149_RS19595 | 3898547..3898990 | + | 444 | WP_000649865.1 | hypothetical protein | - |
| EL149_RS19600 | 3899013..3899480 | + | 468 | WP_001385283.1 | hypothetical protein | - |
| EL149_RS19605 | 3899557..3899796 | + | 240 | WP_000194654.1 | DUF905 domain-containing protein | - |
| EL149_RS19610 | 3899894..3900352 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| EL149_RS19615 | 3900368..3900844 | + | 477 | WP_000811693.1 | RadC family protein | - |
| EL149_RS19620 | 3900853..3901074 | + | 222 | WP_126325800.1 | DUF987 domain-containing protein | - |
| EL149_RS19625 | 3901093..3901410 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| EL149_RS19630 | 3901431..3901772 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| EL149_RS19635 | 3902371..3902730 | + | 360 | WP_001350215.1 | hypothetical protein | - |
| EL149_RS19640 | 3902723..3903265 | - | 543 | WP_000284450.1 | plasmid pRiA4b ORF-3 family protein | - |
| EL149_RS19650 | 3903869..3904150 | - | 282 | WP_000617443.1 | PerC family transcriptional regulator | - |
| EL149_RS19655 | 3904410..3904865 | + | 456 | WP_000230715.1 | hypothetical protein | - |
| EL149_RS19660 | 3904945..3905166 | + | 222 | WP_000678608.1 | hypothetical protein | - |
| EL149_RS19670 | 3905718..3906416 | - | 699 | WP_000594596.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3860192..3932973 | 72781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T287373 WP_000854680.1 NZ_LR134247:3901431-3901772 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|