Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3901093..3901772 Replicon chromosome
Accession NZ_LR134247
Organism Escherichia coli strain NCTC9040

Toxin (Protein)


Gene name ykfI Uniprot ID S1FHS4
Locus tag EL149_RS19630 Protein ID WP_000854680.1
Coordinates 3901431..3901772 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EWR7
Locus tag EL149_RS19625 Protein ID WP_000070396.1
Coordinates 3901093..3901410 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL149_RS19580 3896531..3897352 + 822 WP_000197387.1 DUF945 domain-containing protein -
EL149_RS19585 3897569..3898270 + 702 WP_000189411.1 WYL domain-containing protein -
EL149_RS19590 3898311..3898547 + 237 WP_001144031.1 hypothetical protein -
EL149_RS19595 3898547..3898990 + 444 WP_000649865.1 hypothetical protein -
EL149_RS19600 3899013..3899480 + 468 WP_001385283.1 hypothetical protein -
EL149_RS19605 3899557..3899796 + 240 WP_000194654.1 DUF905 domain-containing protein -
EL149_RS19610 3899894..3900352 + 459 WP_000211838.1 antirestriction protein -
EL149_RS19615 3900368..3900844 + 477 WP_000811693.1 RadC family protein -
EL149_RS19620 3900853..3901074 + 222 WP_126325800.1 DUF987 domain-containing protein -
EL149_RS19625 3901093..3901410 + 318 WP_000070396.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
EL149_RS19630 3901431..3901772 + 342 WP_000854680.1 type IV toxin-antitoxin system toxin YkfI Toxin
EL149_RS19635 3902371..3902730 + 360 WP_001350215.1 hypothetical protein -
EL149_RS19640 3902723..3903265 - 543 WP_000284450.1 plasmid pRiA4b ORF-3 family protein -
EL149_RS19650 3903869..3904150 - 282 WP_000617443.1 PerC family transcriptional regulator -
EL149_RS19655 3904410..3904865 + 456 WP_000230715.1 hypothetical protein -
EL149_RS19660 3904945..3905166 + 222 WP_000678608.1 hypothetical protein -
EL149_RS19670 3905718..3906416 - 699 WP_000594596.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3860192..3932973 72781


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12892.95 Da        Isoelectric Point: 9.6543

>T287373 WP_000854680.1 NZ_LR134247:3901431-3901772 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11982.62 Da        Isoelectric Point: 7.0270

>AT287373 WP_000070396.1 NZ_LR134247:3901093-3901410 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1FHS4

Antitoxin

Source ID Structure
AlphaFold DB S1EWR7

References