Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2618497..2619023 | Replicon | chromosome |
| Accession | NZ_LR134247 | ||
| Organism | Escherichia coli strain NCTC9040 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | EL149_RS13245 | Protein ID | WP_000323025.1 |
| Coordinates | 2618497..2618784 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | EL149_RS13250 | Protein ID | WP_000534858.1 |
| Coordinates | 2618784..2619023 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL149_RS13200 | 2613521..2613736 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| EL149_RS25385 | 2613956..2614126 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| EL149_RS13205 | 2614490..2614705 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| EL149_RS13210 | 2615006..2615218 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| EL149_RS13215 | 2615273..2615362 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| EL149_RS13220 | 2615640..2616392 | - | 753 | WP_001047135.1 | antitermination protein | - |
| EL149_RS13225 | 2616406..2617455 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| EL149_RS13230 | 2617457..2617735 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| EL149_RS13235 | 2617802..2618053 | - | 252 | WP_000980994.1 | hypothetical protein | - |
| EL149_RS13240 | 2618270..2618425 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| EL149_RS13245 | 2618497..2618784 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| EL149_RS13250 | 2618784..2619023 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| EL149_RS13255 | 2619048..2619353 | + | 306 | WP_001326990.1 | hypothetical protein | - |
| EL149_RS13260 | 2619556..2619888 | + | 333 | WP_001301033.1 | protein FlxA | - |
| EL149_RS13265 | 2620325..2621638 | - | 1314 | WP_021558774.1 | ISNCY family transposase | - |
| EL149_RS25270 | 2622407..2622694 | - | 288 | Protein_2567 | hypothetical protein | - |
| EL149_RS13280 | 2623305..2623661 | - | 357 | WP_001310834.1 | class I SAM-dependent methyltransferase | - |
| EL149_RS13285 | 2623658..2623909 | - | 252 | Protein_2569 | DUF977 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2595179..2639275 | 44096 | |
| - | inside | Prophage | - | - | 2585878..2644404 | 58526 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T287367 WP_000323025.1 NZ_LR134247:c2618784-2618497 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|