Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 2529545..2530348 | Replicon | chromosome |
Accession | NZ_LR134247 | ||
Organism | Escherichia coli strain NCTC9040 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A8B2S6X5 |
Locus tag | EL149_RS12700 | Protein ID | WP_048213819.1 |
Coordinates | 2529545..2530075 (-) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A8B2S700 |
Locus tag | EL149_RS12705 | Protein ID | WP_048213818.1 |
Coordinates | 2530079..2530348 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL149_RS12670 | 2525062..2525343 | - | 282 | WP_000639434.1 | hypothetical protein | - |
EL149_RS12675 | 2525492..2525737 | + | 246 | WP_160448951.1 | hypothetical protein | - |
EL149_RS12680 | 2525795..2526583 | - | 789 | WP_001543756.1 | site-specific integrase | - |
EL149_RS25100 | 2526603..2527274 | - | 672 | WP_000796235.1 | hypothetical protein | - |
EL149_RS12690 | 2528206..2528451 | + | 246 | WP_048213821.1 | hypothetical protein | - |
EL149_RS12695 | 2528456..2529460 | + | 1005 | WP_048213820.1 | hypothetical protein | - |
EL149_RS12700 | 2529545..2530075 | - | 531 | WP_048213819.1 | GNAT family N-acetyltransferase | Toxin |
EL149_RS12705 | 2530079..2530348 | - | 270 | WP_048213818.1 | DUF1778 domain-containing protein | Antitoxin |
EL149_RS12710 | 2530563..2531060 | - | 498 | Protein_2457 | IS3 family transposase | - |
EL149_RS12715 | 2531141..2532649 | - | 1509 | WP_126325821.1 | group II intron reverse transcriptase/maturase | - |
EL149_RS12725 | 2533322..2534007 | - | 686 | Protein_2459 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2524584..2560604 | 36020 | |
- | flank | IS/Tn | - | - | 2524584..2524961 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20322.17 Da Isoelectric Point: 6.7544
>T287365 WP_048213819.1 NZ_LR134247:c2530075-2529545 [Escherichia coli]
MDGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYLLVTREDKPRVMGYYTLSGSCFEKTLLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENSNSL
FYPTKSVEELFEVKDE
MDGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYLLVTREDKPRVMGYYTLSGSCFEKTLLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENSNSL
FYPTKSVEELFEVKDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B2S6X5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B2S700 |