Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2432633..2433271 | Replicon | chromosome |
| Accession | NZ_LR134247 | ||
| Organism | Escherichia coli strain NCTC9040 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | EL149_RS12235 | Protein ID | WP_000813794.1 |
| Coordinates | 2432633..2432809 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL149_RS12240 | Protein ID | WP_001270286.1 |
| Coordinates | 2432855..2433271 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL149_RS12215 | 2428253..2429467 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
| EL149_RS12220 | 2429520..2430055 | + | 536 | Protein_2362 | DNA-binding transcriptional regulator SutR | - |
| EL149_RS12225 | 2430128..2432089 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EL149_RS12230 | 2432181..2432411 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| EL149_RS12235 | 2432633..2432809 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EL149_RS12240 | 2432855..2433271 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EL149_RS12245 | 2433350..2434756 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| EL149_RS12250 | 2435001..2436146 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| EL149_RS12255 | 2436164..2437177 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| EL149_RS25245 | 2437178..2438117 | + | 940 | Protein_2370 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287364 WP_000813794.1 NZ_LR134247:2432633-2432809 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287364 WP_001270286.1 NZ_LR134247:2432855-2433271 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|