Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 2209417..2210018 | Replicon | chromosome |
Accession | NZ_LR134247 | ||
Organism | Escherichia coli strain NCTC9040 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | EL149_RS11060 | Protein ID | WP_001216034.1 |
Coordinates | 2209417..2209797 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | EL149_RS11065 | Protein ID | WP_001190712.1 |
Coordinates | 2209797..2210018 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL149_RS11035 | 2204858..2206342 | - | 1485 | WP_000124164.1 | terminase | - |
EL149_RS11040 | 2206342..2207535 | - | 1194 | WP_126325756.1 | terminase | - |
EL149_RS11045 | 2207621..2208073 | - | 453 | WP_016231381.1 | hypothetical protein | - |
EL149_RS11050 | 2208162..2209205 | - | 1044 | WP_126325757.1 | DUF968 domain-containing protein | - |
EL149_RS11055 | 2209233..2209412 | - | 180 | WP_000113018.1 | hypothetical protein | - |
EL149_RS11060 | 2209417..2209797 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
EL149_RS11065 | 2209797..2210018 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL149_RS11070 | 2210201..2211757 | + | 1557 | WP_126325758.1 | type I restriction-modification system subunit M | - |
EL149_RS11075 | 2211754..2212968 | + | 1215 | WP_126325759.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2175298..2258165 | 82867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T287363 WP_001216034.1 NZ_LR134247:c2209797-2209417 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |