Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1857887..1858722 | Replicon | chromosome |
| Accession | NZ_LR134247 | ||
| Organism | Escherichia coli strain NCTC9040 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | EL149_RS08940 | Protein ID | WP_126325736.1 |
| Coordinates | 1857887..1858264 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL149_RS08945 | Protein ID | WP_001548743.1 |
| Coordinates | 1858354..1858722 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL149_RS08900 | 1853349..1853678 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| EL149_RS25045 | 1853779..1853961 | - | 183 | WP_001667686.1 | ethanolamine utilization - propanediol utilization family protein | - |
| EL149_RS08910 | 1854235..1855017 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| EL149_RS08915 | 1855014..1856036 | - | 1023 | Protein_1726 | IS21 family transposase | - |
| EL149_RS25225 | 1856374..1856721 | - | 348 | WP_076487038.1 | transposase | - |
| EL149_RS25230 | 1856705..1856845 | - | 141 | WP_001342279.1 | hypothetical protein | - |
| EL149_RS08930 | 1857561..1857674 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| EL149_RS08935 | 1857687..1857890 | - | 204 | WP_024194799.1 | hypothetical protein | - |
| EL149_RS08940 | 1857887..1858264 | - | 378 | WP_126325736.1 | TA system toxin CbtA family protein | Toxin |
| EL149_RS08945 | 1858354..1858722 | - | 369 | WP_001548743.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL149_RS08950 | 1858885..1859106 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL149_RS08955 | 1859175..1859651 | - | 477 | WP_001548742.1 | RadC family protein | - |
| EL149_RS08960 | 1859667..1860140 | - | 474 | WP_001548741.1 | antirestriction protein | - |
| EL149_RS08970 | 1860482..1861300 | - | 819 | WP_001548740.1 | DUF945 domain-containing protein | - |
| EL149_RS08980 | 1861455..1861613 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgG / csgF / csgE / csgD / csgB / csgA / csgC | 1857687..1894275 | 36588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14127.17 Da Isoelectric Point: 7.8019
>T287361 WP_126325736.1 NZ_LR134247:c1858264-1857887 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13622.38 Da Isoelectric Point: 6.3171
>AT287361 WP_001548743.1 NZ_LR134247:c1858722-1858354 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLEQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLEQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|