Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1926260..1926722 Replicon chromosome
Accession NZ_LR134244
Organism Staphylococcus warneri strain NCTC7291

Toxin (Protein)


Gene name TsaT Uniprot ID A0A2V3ZEQ2
Locus tag EL075_RS09335 Protein ID WP_002465948.1
Coordinates 1926537..1926722 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A364UQZ8
Locus tag EL075_RS09330 Protein ID WP_015365250.1
Coordinates 1926260..1926517 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL075_RS09290 1921468..1921791 + 324 WP_015365247.1 thioredoxin family protein -
EL075_RS09295 1921903..1922442 - 540 WP_002465937.1 nitroreductase -
EL075_RS09300 1922520..1923236 - 717 WP_002465941.1 type I 3-dehydroquinate dehydratase -
EL075_RS09305 1923412..1923834 + 423 WP_002450862.1 organic hydroperoxide resistance protein -
EL075_RS09310 1924112..1924606 + 495 WP_002465942.1 GNAT family N-acetyltransferase -
EL075_RS09315 1924739..1925329 - 591 WP_002465945.1 histidine phosphatase family protein -
EL075_RS09320 1925538..1925771 + 234 WP_002450865.1 hypothetical protein -
EL075_RS09325 1925763..1925966 - 204 WP_015365249.1 sterile alpha motif-like domain-containing protein -
EL075_RS09330 1926260..1926517 + 258 WP_015365250.1 hypothetical protein Antitoxin
EL075_RS09335 1926537..1926722 + 186 WP_002465948.1 hypothetical protein Toxin
EL075_RS09340 1926823..1927404 + 582 WP_015365251.1 hypothetical protein -
EL075_RS09345 1927464..1927697 - 234 WP_002450870.1 hypothetical protein -
EL075_RS09350 1927962..1928714 + 753 WP_002465946.1 poly-gamma-glutamate hydrolase family protein -
EL075_RS09355 1928805..1929089 + 285 WP_002465939.1 hypothetical protein -
EL075_RS09360 1929167..1929382 + 216 WP_002465949.1 hypothetical protein -
EL075_RS09365 1929847..1930086 + 240 WP_002465943.1 hypothetical protein -
EL075_RS09370 1930315..1930548 + 234 WP_015365252.1 hypothetical protein -
EL075_RS09375 1930723..1930923 - 201 WP_002450876.1 cold-shock protein -
EL075_RS09380 1931244..1931609 - 366 WP_002466279.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6977.68 Da        Isoelectric Point: 10.1605

>T287356 WP_002465948.1 NZ_LR134244:1926537-1926722 [Staphylococcus warneri]
MSLHFTILFWLSLIFIVAGAIILAIMLKTKKESKKESYLGFTIVFFIFGLAMLIYTLLFGL

Download         Length: 186 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9908.17 Da        Isoelectric Point: 4.5910

>AT287356 WP_015365250.1 NZ_LR134244:1926260-1926517 [Staphylococcus warneri]
MKLYIIHAINIILTILFIIFNVIITYNANLDDTLWLVPGLIVCGLIMMISFAIAITKKDLLSEVLFFINIILTLYYIYPI
FYDFL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2V3ZEQ2

Antitoxin

Source ID Structure
AlphaFold DB A0A364UQZ8

References