Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 958800..959606 | Replicon | chromosome |
| Accession | NZ_LR134244 | ||
| Organism | Staphylococcus warneri strain NCTC7291 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | A0A364UNB4 |
| Locus tag | EL075_RS04745 | Protein ID | WP_002466824.1 |
| Coordinates | 959427..959606 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | EL075_RS04740 | Protein ID | WP_126403145.1 |
| Coordinates | 958800..959399 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL075_RS04720 | 954601..956061 | + | 1461 | WP_126403143.1 | ABC transporter substrate-binding protein/permease | - |
| EL075_RS04725 | 956054..956776 | + | 723 | WP_002466809.1 | amino acid ABC transporter ATP-binding protein | - |
| EL075_RS04730 | 957019..958149 | + | 1131 | WP_002466804.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| EL075_RS04735 | 958150..958620 | + | 471 | WP_126403144.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| EL075_RS04740 | 958800..959399 | + | 600 | WP_126403145.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| EL075_RS04745 | 959427..959606 | + | 180 | WP_002466824.1 | hypothetical protein | Toxin |
| EL075_RS04750 | 959749..960141 | + | 393 | WP_015364871.1 | hypothetical protein | - |
| EL075_RS04755 | 960296..961681 | + | 1386 | WP_002466811.1 | class II fumarate hydratase | - |
| EL075_RS04760 | 961742..962572 | - | 831 | WP_002466807.1 | RluA family pseudouridine synthase | - |
| EL075_RS04765 | 962750..963862 | + | 1113 | WP_002466816.1 | GAF domain-containing sensor histidine kinase | - |
| EL075_RS04770 | 963883..964506 | + | 624 | WP_002466822.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6901.22 Da Isoelectric Point: 3.8441
>T287353 WP_002466824.1 NZ_LR134244:959427-959606 [Staphylococcus warneri]
MTQNKDSKTNYHEEENAMVTDLDDLKDLGKEMEQISEENDEEKLNQSHDSDVRSDLDQD
MTQNKDSKTNYHEEENAMVTDLDDLKDLGKEMEQISEENDEEKLNQSHDSDVRSDLDQD
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22630.53 Da Isoelectric Point: 4.8492
>AT287353 WP_126403145.1 NZ_LR134244:958800-959399 [Staphylococcus warneri]
MAMNFKVFEDKQRVAEYTADILRKQFNNNPMTIAGVHLTKDHAPVLDELKKNVDLHAVDFSQINILDYDENQSYYEALGV
PQSQIYSLSYNQDANDFISDKIKTKENKGKLVLQVVSIDENGNLDVSVRQGLLEAREIFLVVTGSNKREVVEKLYNENGK
SNFEPADLKVHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFEDKQRVAEYTADILRKQFNNNPMTIAGVHLTKDHAPVLDELKKNVDLHAVDFSQINILDYDENQSYYEALGV
PQSQIYSLSYNQDANDFISDKIKTKENKGKLVLQVVSIDENGNLDVSVRQGLLEAREIFLVVTGSNKREVVEKLYNENGK
SNFEPADLKVHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|