Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 820164..820693 | Replicon | chromosome |
Accession | NZ_LR134244 | ||
Organism | Staphylococcus warneri strain NCTC7291 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2T4PXE7 |
Locus tag | EL075_RS03955 | Protein ID | WP_002451625.1 |
Coordinates | 820331..820693 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2T4PXF4 |
Locus tag | EL075_RS03950 | Protein ID | WP_002451626.1 |
Coordinates | 820164..820334 (+) | Length | 57 a.a. |
Genomic Context
Location: 815989..816462 (474 bp)
Type: Others
Protein ID: WP_002466763.1
Type: Others
Protein ID: WP_002466763.1
Location: 816455..817981 (1527 bp)
Type: Others
Protein ID: WP_002466774.1
Type: Others
Protein ID: WP_002466774.1
Location: 817968..818471 (504 bp)
Type: Others
Protein ID: WP_015364833.1
Type: Others
Protein ID: WP_015364833.1
Location: 818498..818872 (375 bp)
Type: Others
Protein ID: WP_002466788.1
Type: Others
Protein ID: WP_002466788.1
Location: 818924..820072 (1149 bp)
Type: Others
Protein ID: WP_015364834.1
Type: Others
Protein ID: WP_015364834.1
Location: 820164..820334 (171 bp)
Type: Antitoxin
Protein ID: WP_002451626.1
Type: Antitoxin
Protein ID: WP_002451626.1
Location: 820331..820693 (363 bp)
Type: Toxin
Protein ID: WP_002451625.1
Type: Toxin
Protein ID: WP_002451625.1
Location: 821016..822017 (1002 bp)
Type: Others
Protein ID: WP_002466762.1
Type: Others
Protein ID: WP_002466762.1
Location: 822111..822437 (327 bp)
Type: Others
Protein ID: WP_002466754.1
Type: Others
Protein ID: WP_002466754.1
Location: 822439..822918 (480 bp)
Type: Others
Protein ID: WP_002466768.1
Type: Others
Protein ID: WP_002466768.1
Location: 822893..823663 (771 bp)
Type: Others
Protein ID: Protein_785
Type: Others
Protein ID: Protein_785
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL075_RS03925 | 815989..816462 | + | 474 | WP_002466763.1 | PH domain-containing protein | - |
EL075_RS03930 | 816455..817981 | + | 1527 | WP_002466774.1 | PH domain-containing protein | - |
EL075_RS03935 | 817968..818471 | + | 504 | WP_015364833.1 | PH domain-containing protein | - |
EL075_RS03940 | 818498..818872 | + | 375 | WP_002466788.1 | holo-ACP synthase | - |
EL075_RS03945 | 818924..820072 | + | 1149 | WP_015364834.1 | alanine racemase | - |
EL075_RS03950 | 820164..820334 | + | 171 | WP_002451626.1 | hypothetical protein | Antitoxin |
EL075_RS03955 | 820331..820693 | + | 363 | WP_002451625.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL075_RS03965 | 821016..822017 | + | 1002 | WP_002466762.1 | PP2C family protein-serine/threonine phosphatase | - |
EL075_RS03970 | 822111..822437 | + | 327 | WP_002466754.1 | anti-sigma factor antagonist | - |
EL075_RS03975 | 822439..822918 | + | 480 | WP_002466768.1 | anti-sigma B factor RsbW | - |
EL075_RS03980 | 822893..823663 | + | 771 | Protein_785 | RNA polymerase sigma factor SigB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13562.68 Da Isoelectric Point: 9.9783
>T287352 WP_002451625.1 NZ_LR134244:820331-820693 [Staphylococcus warneri]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFNHSKT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFNHSKT
Download Length: 363 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T4PXE7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T4PXF4 |