Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 820164..820693 | Replicon | chromosome |
| Accession | NZ_LR134244 | ||
| Organism | Staphylococcus warneri strain NCTC7291 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2T4PXE7 |
| Locus tag | EL075_RS03955 | Protein ID | WP_002451625.1 |
| Coordinates | 820331..820693 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A2T4PXF4 |
| Locus tag | EL075_RS03950 | Protein ID | WP_002451626.1 |
| Coordinates | 820164..820334 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL075_RS03925 | 815989..816462 | + | 474 | WP_002466763.1 | PH domain-containing protein | - |
| EL075_RS03930 | 816455..817981 | + | 1527 | WP_002466774.1 | PH domain-containing protein | - |
| EL075_RS03935 | 817968..818471 | + | 504 | WP_015364833.1 | PH domain-containing protein | - |
| EL075_RS03940 | 818498..818872 | + | 375 | WP_002466788.1 | holo-ACP synthase | - |
| EL075_RS03945 | 818924..820072 | + | 1149 | WP_015364834.1 | alanine racemase | - |
| EL075_RS03950 | 820164..820334 | + | 171 | WP_002451626.1 | hypothetical protein | Antitoxin |
| EL075_RS03955 | 820331..820693 | + | 363 | WP_002451625.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL075_RS03965 | 821016..822017 | + | 1002 | WP_002466762.1 | PP2C family protein-serine/threonine phosphatase | - |
| EL075_RS03970 | 822111..822437 | + | 327 | WP_002466754.1 | anti-sigma factor antagonist | - |
| EL075_RS03975 | 822439..822918 | + | 480 | WP_002466768.1 | anti-sigma B factor RsbW | - |
| EL075_RS03980 | 822893..823663 | + | 771 | Protein_785 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13562.68 Da Isoelectric Point: 9.9783
>T287352 WP_002451625.1 NZ_LR134244:820331-820693 [Staphylococcus warneri]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFNHSKT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFNHSKT
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T4PXE7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T4PXF4 |