287349

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1912480..1912942 Replicon chromosome
Accession NZ_LR134242
Organism Staphylococcus warneri strain NCTC4133

Toxin (Protein)


Gene name TsaT Uniprot ID A0A2V3ZEQ2
Locus tag EL068_RS09200 Protein ID WP_002465948.1
Coordinates 1912757..1912942 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A364UQZ8
Locus tag EL068_RS09195 Protein ID WP_015365250.1
Coordinates 1912480..1912737 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL068_RS09155 1907686..1908009 + 324 WP_015365247.1 thioredoxin family protein -
EL068_RS09160 1908121..1908660 - 540 WP_002465937.1 nitroreductase -
EL068_RS09165 1908738..1909454 - 717 WP_058709950.1 type I 3-dehydroquinate dehydratase -
EL068_RS09170 1909631..1910053 + 423 WP_126510473.1 organic hydroperoxide resistance protein -
EL068_RS09175 1910331..1910825 + 495 WP_002465942.1 GNAT family N-acetyltransferase -
EL068_RS09180 1910958..1911548 - 591 WP_058709949.1 histidine phosphatase family protein -
EL068_RS09185 1911757..1911990 + 234 WP_002450865.1 hypothetical protein -
EL068_RS09190 1911982..1912185 - 204 WP_015365249.1 sterile alpha motif-like domain-containing protein -
EL068_RS09195 1912480..1912737 + 258 WP_015365250.1 hypothetical protein Antitoxin
EL068_RS09200 1912757..1912942 + 186 WP_002465948.1 hypothetical protein Toxin
EL068_RS09205 1913043..1913624 + 582 WP_126510474.1 hypothetical protein -
EL068_RS09210 1913684..1913917 - 234 WP_002450870.1 hypothetical protein -
EL068_RS09215 1914182..1914934 + 753 WP_126510475.1 poly-gamma-glutamate hydrolase family protein -
EL068_RS09220 1915025..1915309 + 285 WP_002465939.1 hypothetical protein -
EL068_RS09225 1915387..1915602 + 216 WP_126510476.1 hypothetical protein -
EL068_RS09230 1916067..1916306 + 240 WP_002465943.1 hypothetical protein -
EL068_RS09235 1916535..1916768 + 234 WP_015365252.1 hypothetical protein -
EL068_RS09240 1916942..1917142 - 201 WP_002450876.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6977.68 Da        Isoelectric Point: 10.1605

>T287349 WP_002465948.1 NZ_LR134242:1912757-1912942 [Staphylococcus warneri]
MSLHFTILFWLSLIFIVAGAIILAIMLKTKKESKKESYLGFTIVFFIFGLAMLIYTLLFGL

Download         Length: 186 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9908.17 Da        Isoelectric Point: 4.5910

>AT287349 WP_015365250.1 NZ_LR134242:1912480-1912737 [Staphylococcus warneri]
MKLYIIHAINIILTILFIIFNVIITYNANLDDTLWLVPGLIVCGLIMMISFAIAITKKDLLSEVLFFINIILTLYYIYPI
FYDFL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2V3ZEQ2

Antitoxin

Source ID Structure
AlphaFold DB A0A364UQZ8

References