Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 999620..1000426 | Replicon | chromosome |
Accession | NZ_LR134242 | ||
Organism | Staphylococcus warneri strain NCTC4133 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | A0A364UNB4 |
Locus tag | EL068_RS04960 | Protein ID | WP_002466824.1 |
Coordinates | 1000247..1000426 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | EL068_RS04955 | Protein ID | WP_058710200.1 |
Coordinates | 999620..1000219 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL068_RS04935 | 995422..996882 | + | 1461 | WP_126510291.1 | ABC transporter substrate-binding protein/permease | - |
EL068_RS04940 | 996875..997597 | + | 723 | WP_002466809.1 | amino acid ABC transporter ATP-binding protein | - |
EL068_RS04945 | 997839..998969 | + | 1131 | WP_058710201.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
EL068_RS04950 | 998970..999440 | + | 471 | WP_002466802.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
EL068_RS04955 | 999620..1000219 | + | 600 | WP_058710200.1 | hypothetical protein | Antitoxin |
EL068_RS04960 | 1000247..1000426 | + | 180 | WP_002466824.1 | hypothetical protein | Toxin |
EL068_RS04965 | 1000569..1000961 | + | 393 | WP_015364871.1 | hypothetical protein | - |
EL068_RS04970 | 1001116..1002501 | + | 1386 | WP_058710199.1 | class II fumarate hydratase | - |
EL068_RS04975 | 1002560..1003390 | - | 831 | WP_002466807.1 | RluA family pseudouridine synthase | - |
EL068_RS04980 | 1003568..1004680 | + | 1113 | WP_126510292.1 | GAF domain-containing sensor histidine kinase | - |
EL068_RS04985 | 1004701..1005324 | + | 624 | WP_002466822.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6901.22 Da Isoelectric Point: 3.8441
>T287346 WP_002466824.1 NZ_LR134242:1000247-1000426 [Staphylococcus warneri]
MTQNKDSKTNYHEEENAMVTDLDDLKDLGKEMEQISEENDEEKLNQSHDSDVRSDLDQD
MTQNKDSKTNYHEEENAMVTDLDDLKDLGKEMEQISEENDEEKLNQSHDSDVRSDLDQD
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22545.47 Da Isoelectric Point: 4.9641
>AT287346 WP_058710200.1 NZ_LR134242:999620-1000219 [Staphylococcus warneri]
MAMNFKVFEDKQRVAEYTADILRKQFNNNPMTIAGVHLTKDHAPVLDELKKNVDLHAVDFSQINILDYDENQSYYEALGV
PQSQIYSLSYNQDANDFISDKIKTKENKGKLVLQVVSIDVSGNLDVSVRQGLLEAREIFLVVTGSNKREVVEKLYNENGK
SNFEPADLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFEDKQRVAEYTADILRKQFNNNPMTIAGVHLTKDHAPVLDELKKNVDLHAVDFSQINILDYDENQSYYEALGV
PQSQIYSLSYNQDANDFISDKIKTKENKGKLVLQVVSIDVSGNLDVSVRQGLLEAREIFLVVTGSNKREVVEKLYNENGK
SNFEPADLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|