Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 848438..848967 | Replicon | chromosome |
Accession | NZ_LR134242 | ||
Organism | Staphylococcus warneri strain NCTC4133 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL068_RS04075 | Protein ID | WP_058709711.1 |
Coordinates | 848605..848967 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2T4PXF4 |
Locus tag | EL068_RS04070 | Protein ID | WP_002451626.1 |
Coordinates | 848438..848608 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL068_RS04045 | 844263..844736 | + | 474 | WP_058709708.1 | PH domain-containing protein | - |
EL068_RS04050 | 844729..846255 | + | 1527 | WP_058709716.1 | PH domain-containing protein | - |
EL068_RS04055 | 846242..846745 | + | 504 | WP_126510262.1 | PH domain-containing protein | - |
EL068_RS04060 | 846772..847146 | + | 375 | WP_058709709.1 | holo-ACP synthase | - |
EL068_RS04065 | 847198..848346 | + | 1149 | WP_058709710.1 | alanine racemase | - |
EL068_RS04070 | 848438..848608 | + | 171 | WP_002451626.1 | hypothetical protein | Antitoxin |
EL068_RS04075 | 848605..848967 | + | 363 | WP_058709711.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL068_RS04085 | 849290..850291 | + | 1002 | WP_058709712.1 | PP2C family protein-serine/threonine phosphatase | - |
EL068_RS04090 | 850385..850707 | + | 323 | Protein_805 | anti-sigma factor antagonist | - |
EL068_RS04095 | 850709..851188 | + | 480 | WP_002466768.1 | anti-sigma B factor RsbW | - |
EL068_RS04100 | 851163..851933 | + | 771 | Protein_807 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13585.72 Da Isoelectric Point: 9.9784
>T287345 WP_058709711.1 NZ_LR134242:848605-848967 [Staphylococcus warneri]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFHHSKT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFHHSKT
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|