Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4091572..4092404 | Replicon | chromosome |
| Accession | NZ_LR134240 | ||
| Organism | Escherichia coli strain NCTC9107 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0Q2Y5N3 |
| Locus tag | EL129_RS19995 | Protein ID | WP_001514886.1 |
| Coordinates | 4091572..4091946 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | EL129_RS20000 | Protein ID | WP_001360327.1 |
| Coordinates | 4092036..4092404 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL129_RS23280 | 4089296..4089454 | - | 159 | WP_001467148.1 | hypothetical protein | - |
| EL129_RS19975 | 4089554..4089730 | - | 177 | WP_000839290.1 | DUF957 domain-containing protein | - |
| EL129_RS19980 | 4089747..4090109 | - | 363 | Protein_3868 | hypothetical protein | - |
| EL129_RS19985 | 4090203..4091432 | + | 1230 | Protein_3869 | IS3 family transposase | - |
| EL129_RS19990 | 4091357..4091575 | - | 219 | WP_001514887.1 | hypothetical protein | - |
| EL129_RS19995 | 4091572..4091946 | - | 375 | WP_001514886.1 | TA system toxin CbtA family protein | Toxin |
| EL129_RS20000 | 4092036..4092404 | - | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL129_RS20005 | 4092567..4092788 | - | 222 | WP_000692286.1 | DUF987 domain-containing protein | - |
| EL129_RS20010 | 4092851..4093327 | - | 477 | WP_001186774.1 | RadC family protein | - |
| EL129_RS20015 | 4093343..4093825 | - | 483 | WP_001508976.1 | antirestriction protein | - |
| EL129_RS20020 | 4093917..4094735 | - | 819 | WP_001508975.1 | DUF945 domain-containing protein | - |
| EL129_RS20030 | 4094890..4095048 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
| EL129_RS20035 | 4095243..4095989 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 4090203..4097545 | 7342 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13930.91 Da Isoelectric Point: 7.2909
>T287341 WP_001514886.1 NZ_LR134240:c4091946-4091572 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT287341 WP_001360327.1 NZ_LR134240:c4092404-4092036 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q2Y5N3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |