Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3520626..3521244 | Replicon | chromosome |
| Accession | NZ_LR134240 | ||
| Organism | Escherichia coli strain NCTC9107 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | EL129_RS17330 | Protein ID | WP_001291435.1 |
| Coordinates | 3521026..3521244 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | EL129_RS17325 | Protein ID | WP_000344800.1 |
| Coordinates | 3520626..3521000 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL129_RS17315 | 3515715..3516908 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL129_RS17320 | 3516931..3520080 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| EL129_RS17325 | 3520626..3521000 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| EL129_RS17330 | 3521026..3521244 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| EL129_RS17335 | 3521416..3521967 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| EL129_RS17340 | 3522083..3522553 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| EL129_RS17345 | 3522717..3524267 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| EL129_RS17350 | 3524309..3524662 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| EL129_RS17360 | 3525041..3525352 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| EL129_RS17365 | 3525383..3525955 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T287337 WP_001291435.1 NZ_LR134240:3521026-3521244 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT287337 WP_000344800.1 NZ_LR134240:3520626-3521000 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |