Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 940795..941449 | Replicon | chromosome |
Accession | NZ_LR134240 | ||
Organism | Escherichia coli strain NCTC9107 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | EL129_RS04665 | Protein ID | WP_000244781.1 |
Coordinates | 941042..941449 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | EL129_RS04660 | Protein ID | WP_000354046.1 |
Coordinates | 940795..941061 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL129_RS04640 | 936883..938316 | - | 1434 | WP_024210543.1 | 6-phospho-beta-glucosidase BglA | - |
EL129_RS04645 | 938361..938672 | + | 312 | WP_001182958.1 | N(4)-acetylcytidine aminohydrolase | - |
EL129_RS04650 | 938836..939495 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
EL129_RS04655 | 939572..940552 | - | 981 | WP_000886075.1 | tRNA-modifying protein YgfZ | - |
EL129_RS04660 | 940795..941061 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
EL129_RS04665 | 941042..941449 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
EL129_RS04670 | 941489..942010 | - | 522 | WP_001055872.1 | flavodoxin FldB | - |
EL129_RS04675 | 942122..943018 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
EL129_RS04680 | 943043..943753 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL129_RS04685 | 943759..945492 | + | 1734 | WP_000813176.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T287327 WP_000244781.1 NZ_LR134240:941042-941449 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|