Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 839211..840045 | Replicon | chromosome |
Accession | NZ_LR134240 | ||
Organism | Escherichia coli strain NCTC9107 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A2T3TJB4 |
Locus tag | EL129_RS04065 | Protein ID | WP_000854811.1 |
Coordinates | 839211..839588 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | EL129_RS04070 | Protein ID | WP_126324601.1 |
Coordinates | 839677..840045 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL129_RS04045 | 837009..838229 | + | 1221 | WP_000794251.1 | capsular biosynthesis protein | - |
EL129_RS04050 | 838252..838488 | - | 237 | WP_000986719.1 | hypothetical protein | - |
EL129_RS04055 | 838591..838767 | - | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
EL129_RS04060 | 838784..839214 | - | 431 | Protein_792 | hypothetical protein | - |
EL129_RS04065 | 839211..839588 | - | 378 | WP_000854811.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
EL129_RS04070 | 839677..840045 | - | 369 | WP_126324601.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
EL129_RS04075 | 840119..840340 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
EL129_RS04080 | 840409..840885 | - | 477 | WP_001186725.1 | RadC family protein | - |
EL129_RS04085 | 840901..841386 | - | 486 | WP_000214310.1 | antirestriction protein | - |
EL129_RS04090 | 841478..842296 | - | 819 | WP_061354001.1 | DUF945 domain-containing protein | - |
EL129_RS04100 | 842451..842609 | - | 159 | WP_001556217.1 | DUF905 family protein | - |
EL129_RS04105 | 842688..843143 | - | 456 | WP_001556216.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14041.14 Da Isoelectric Point: 7.8839
>T287326 WP_000854811.1 NZ_LR134240:c839588-839211 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13661.55 Da Isoelectric Point: 6.9552
>AT287326 WP_126324601.1 NZ_LR134240:c840045-839677 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPRTVTPCFGARLVQEGNRLHYLADRAGIRGLYSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPRTVTPCFGARLVQEGNRLHYLADRAGIRGLYSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|