Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3895266..3896098 Replicon chromosome
Accession NZ_LR134239
Organism Escherichia coli strain NCTC9100

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag EL124_RS18940 Protein ID WP_000854753.1
Coordinates 3895266..3895640 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID V0ULY5
Locus tag EL124_RS18945 Protein ID WP_001315620.1
Coordinates 3895730..3896098 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL124_RS18895 3890481..3891587 + 1107 WP_001341302.1 N-acetylneuraminate epimerase -
EL124_RS18900 3891652..3892632 + 981 WP_000991415.1 9-O-acetyl-N-acetylneuraminic acid deacetylase -
EL124_RS18905 3892640..3893290 - 651 WP_001037966.1 HNH endonuclease -
EL124_RS22070 3894335..3894487 - 153 WP_001280445.1 hypothetical protein -
EL124_RS18930 3894572..3894769 - 198 WP_000839281.1 DUF957 domain-containing protein -
EL124_RS18935 3894781..3895269 - 489 WP_000777547.1 hypothetical protein -
EL124_RS18940 3895266..3895640 - 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
EL124_RS18945 3895730..3896098 - 369 WP_001315620.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL124_RS18950 3896261..3896482 - 222 WP_000692345.1 DUF987 domain-containing protein -
EL124_RS18955 3896545..3897021 - 477 WP_001186774.1 RadC family protein -
EL124_RS18960 3897037..3897207 - 171 Protein_3686 antirestriction protein -
EL124_RS18965 3897192..3898727 - 1536 WP_000939409.1 hypothetical protein -
EL124_RS22140 3898848..3899054 - 207 Protein_3688 autotransporter adhesin family protein -
EL124_RS18980 3899802..3899927 + 126 Protein_3689 hemolysin activation protein -
EL124_RS18985 3900136..3900336 - 201 WP_000823256.1 hypothetical protein -
EL124_RS18990 3900618..3900749 + 132 Protein_3691 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T287321 WP_000854753.1 NZ_LR134239:c3895640-3895266 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13474.20 Da        Isoelectric Point: 6.2050

>AT287321 WP_001315620.1 NZ_LR134239:c3896098-3895730 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB V0ULY5

References