Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4262196..4262746 Replicon chromosome
Accession NZ_LR134237
Organism Escherichia coli strain NCTC9022

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag EL138_RS21190 Protein ID WP_001160966.1
Coordinates 4262196..4262510 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag EL138_RS21195 Protein ID WP_000125566.1
Coordinates 4262513..4262746 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL138_RS21165 4257871..4259157 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
EL138_RS21170 4259157..4260146 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
EL138_RS21175 4260143..4260964 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
EL138_RS21180 4260967..4261344 + 378 WP_000610907.1 Co2+/Mg2+ efflux protein ApaG -
EL138_RS21185 4261351..4262199 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
EL138_RS21190 4262196..4262510 - 315 WP_001160966.1 CcdB family protein Toxin
EL138_RS21195 4262513..4262746 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EL138_RS21200 4262832..4263311 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
EL138_RS21205 4263503..4265365 - 1863 WP_000377123.1 glutathione-regulated potassium-efflux system protein KefC -
EL138_RS21210 4265358..4265888 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
EL138_RS21215 4265996..4267327 - 1332 WP_001183207.1 MFS transporter -
EL138_RS21220 4267386..4267673 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T287297 WP_001160966.1 NZ_LR134237:c4262510-4262196 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT287297 WP_000125566.1 NZ_LR134237:c4262746-4262513 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References