Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4063062..4063860 Replicon chromosome
Accession NZ_LR134237
Organism Escherichia coli strain NCTC9022

Toxin (Protein)


Gene name yeeV Uniprot ID Q8VRA6
Locus tag EL138_RS20265 Protein ID WP_000854730.1
Coordinates 4063483..4063860 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P0SQV8
Locus tag EL138_RS20260 Protein ID WP_001285481.1
Coordinates 4063062..4063436 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL138_RS20220 4059036..4059488 + 453 WP_000682723.1 hypothetical protein -
EL138_RS20225 4059606..4059839 + 234 WP_001213776.1 DUF905 family protein -
EL138_RS20230 4059939..4060760 + 822 WP_001234359.1 DUF945 domain-containing protein -
EL138_RS20235 4060760..4061005 + 246 WP_001164966.1 hypothetical protein -
EL138_RS20240 4061100..4061573 + 474 WP_001313575.1 antirestriction protein -
EL138_RS20245 4061589..4062065 + 477 WP_001313574.1 RadC family protein -
EL138_RS20250 4062128..4062349 + 222 WP_000692315.1 DUF987 domain-containing protein -
EL138_RS20255 4062368..4063012 + 645 WP_000086759.1 hypothetical protein -
EL138_RS20260 4063062..4063436 + 375 WP_001285481.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL138_RS20265 4063483..4063860 + 378 WP_000854730.1 TA system toxin CbtA family protein Toxin
EL138_RS20270 4063857..4064349 + 493 Protein_3869 hypothetical protein -
EL138_RS20275 4064428..4065416 - 989 Protein_3870 IS630 family transposase -
EL138_RS20280 4065564..4065752 - 189 Protein_3871 IS66 family transposase -
EL138_RS20285 4065813..4066946 + 1134 WP_000555401.1 IS110-like element ISEc45 family transposase -
EL138_RS20290 4067200..4068604 - 1405 Protein_3873 IS66 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14212.21 Da        Isoelectric Point: 7.2923

>T287296 WP_000854730.1 NZ_LR134237:4063483-4063860 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13817.53 Da        Isoelectric Point: 4.7511

>AT287296 WP_001285481.1 NZ_LR134237:4063062-4063436 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V671

Antitoxin

Source ID Structure
AlphaFold DB A0A0P0SQV8

References