Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3758704..3759322 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | EL138_RS18730 | Protein ID | WP_001291435.1 |
| Coordinates | 3759104..3759322 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | EL138_RS18725 | Protein ID | WP_000344800.1 |
| Coordinates | 3758704..3759078 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS18715 | 3753794..3754987 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL138_RS18720 | 3755010..3758159 | + | 3150 | WP_001132480.1 | multidrug efflux RND transporter permease subunit | - |
| EL138_RS18725 | 3758704..3759078 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| EL138_RS18730 | 3759104..3759322 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| EL138_RS18735 | 3759495..3760046 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| EL138_RS18740 | 3760162..3760632 | + | 471 | WP_001304825.1 | YlaC family protein | - |
| EL138_RS18745 | 3760796..3762346 | + | 1551 | WP_001528761.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| EL138_RS18750 | 3762388..3762741 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| EL138_RS18760 | 3763120..3763431 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| EL138_RS18765 | 3763462..3764034 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T287295 WP_001291435.1 NZ_LR134237:3759104-3759322 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT287295 WP_000344800.1 NZ_LR134237:3758704-3759078 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |