Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3766402..3767189 Replicon chromosome
Accession NZ_LR134236
Organism Escherichia coli strain NCTC9008

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag EL127_RS18565 Protein ID WP_023280984.1
Coordinates 3766812..3767189 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2H9G3E7
Locus tag EL127_RS18560 Protein ID WP_000066236.1
Coordinates 3766402..3766761 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL127_RS18510 3761641..3762093 + 453 WP_001020418.1 hypothetical protein -
EL127_RS18515 3762090..3762542 + 453 WP_004011054.1 hypothetical protein -
EL127_RS18520 3762605..3763147 + 543 WP_001104018.1 DUF4339 domain-containing protein -
EL127_RS18525 3763207..3763659 + 453 WP_001061894.1 hypothetical protein -
EL127_RS18530 3763736..3763969 + 234 WP_001114682.1 DUF905 domain-containing protein -
EL127_RS18535 3764089..3764907 + 819 WP_126497081.1 DUF945 domain-containing protein -
EL127_RS18545 3765175..3765645 + 471 WP_000131762.1 antirestriction protein -
EL127_RS18550 3765657..3766136 + 480 WP_000437750.1 DNA repair protein RadC -
EL127_RS18555 3766157..3766378 + 222 WP_000691981.1 DUF987 domain-containing protein -
EL127_RS18560 3766402..3766761 + 360 WP_000066236.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL127_RS18565 3766812..3767189 + 378 WP_023280984.1 TA system toxin CbtA family protein Toxin
EL127_RS18570 3767186..3767677 + 492 WP_000777682.1 hypothetical protein -
EL127_RS18575 3767709..3767912 + 204 WP_000413747.1 DUF957 domain-containing protein -
EL127_RS18580 3767993..3768837 + 845 Protein_3608 DUF4942 domain-containing protein -
EL127_RS18590 3769179..3769910 - 732 WP_001300756.1 DNA polymerase III subunit epsilon -
EL127_RS18595 3769975..3770442 + 468 WP_000917883.1 ribonuclease HI -
EL127_RS18600 3770439..3771161 - 723 WP_001297210.1 class I SAM-dependent methyltransferase -
EL127_RS18605 3771195..3771950 + 756 WP_001052717.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14204.95 Da        Isoelectric Point: 7.4733

>T287279 WP_023280984.1 NZ_LR134236:3766812-3767189 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRHTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13127.02 Da        Isoelectric Point: 7.0261

>AT287279 WP_000066236.1 NZ_LR134236:3766402-3766761 [Escherichia coli]
MSNKIPTVNHDITEPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2H9G3E7

References