Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2491406..2492044 | Replicon | chromosome |
Accession | NZ_LR134236 | ||
Organism | Escherichia coli strain NCTC9008 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EL127_RS12135 | Protein ID | WP_000813794.1 |
Coordinates | 2491868..2492044 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL127_RS12130 | Protein ID | WP_001270286.1 |
Coordinates | 2491406..2491822 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL127_RS12110 | 2486558..2487499 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
EL127_RS12115 | 2487500..2488513 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
EL127_RS12120 | 2488531..2489676 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
EL127_RS12125 | 2489921..2491327 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
EL127_RS12130 | 2491406..2491822 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL127_RS12135 | 2491868..2492044 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL127_RS12140 | 2492266..2492496 | + | 231 | WP_000494244.1 | YncJ family protein | - |
EL127_RS12145 | 2492588..2494549 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL127_RS12150 | 2494622..2495158 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
EL127_RS12155 | 2495211..2495867 | + | 657 | Protein_2358 | BenE family transporter YdcO | - |
EL127_RS12160 | 2495884..2496581 | - | 698 | Protein_2359 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2491406..2507958 | 16552 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287274 WP_000813794.1 NZ_LR134236:c2492044-2491868 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287274 WP_001270286.1 NZ_LR134236:c2491822-2491406 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|