Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1873776..1874608 | Replicon | chromosome |
| Accession | NZ_LR134236 | ||
| Organism | Escherichia coli strain NCTC9008 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | EL127_RS08965 | Protein ID | WP_000854762.1 |
| Coordinates | 1873776..1874150 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL127_RS08970 | Protein ID | WP_126496977.1 |
| Coordinates | 1874240..1874608 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL127_RS08925 | 1869235..1869564 | + | 330 | WP_126496975.1 | DUF496 family protein | - |
| EL127_RS23265 | 1869665..1869847 | - | 183 | WP_001667686.1 | ethanolamine utilization - propanediol utilization family protein | - |
| EL127_RS08935 | 1870121..1870903 | - | 783 | WP_072277875.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| EL127_RS08940 | 1870900..1871922 | - | 1023 | WP_126496976.1 | IS21 family transposase | - |
| EL127_RS23375 | 1872260..1872631 | - | 372 | WP_001445978.1 | IS110 family transposase | - |
| EL127_RS23485 | 1872591..1872731 | - | 141 | WP_214018942.1 | hypothetical protein | - |
| EL127_RS08955 | 1873447..1873560 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| EL127_RS08960 | 1873573..1873779 | - | 207 | WP_000976829.1 | hypothetical protein | - |
| EL127_RS08965 | 1873776..1874150 | - | 375 | WP_000854762.1 | TA system toxin CbtA family protein | Toxin |
| EL127_RS08970 | 1874240..1874608 | - | 369 | WP_126496977.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL127_RS08975 | 1874771..1874992 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL127_RS08980 | 1875055..1875531 | - | 477 | WP_001186775.1 | RadC family protein | - |
| EL127_RS08985 | 1875547..1876020 | - | 474 | WP_001387789.1 | antirestriction protein | - |
| EL127_RS23380 | 1876209..1876361 | - | 153 | WP_181042524.1 | hypothetical protein | - |
| EL127_RS08995 | 1876361..1877179 | - | 819 | WP_126496978.1 | DUF945 domain-containing protein | - |
| EL127_RS09005 | 1877334..1877492 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
| EL127_RS09010 | 1877563..1879062 | - | 1500 | Protein_1754 | autotransporter adhesin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14094.15 Da Isoelectric Point: 7.1881
>T287267 WP_000854762.1 NZ_LR134236:c1874150-1873776 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13588.41 Da Isoelectric Point: 6.6255
>AT287267 WP_126496977.1 NZ_LR134236:c1874608-1874240 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADPLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADPLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|