Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 1280058..1280659 | Replicon | chromosome |
Accession | NZ_LR134236 | ||
Organism | Escherichia coli strain NCTC9008 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | EL127_RS06255 | Protein ID | WP_001216034.1 |
Coordinates | 1280058..1280438 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | EL127_RS06260 | Protein ID | WP_001190712.1 |
Coordinates | 1280438..1280659 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL127_RS06220 | 1275109..1276041 | - | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
EL127_RS06225 | 1276028..1277431 | - | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
EL127_RS06230 | 1277675..1278655 | + | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
EL127_RS06235 | 1278883..1279200 | + | 318 | WP_001513659.1 | hypothetical protein | - |
EL127_RS06240 | 1279150..1279563 | - | 414 | Protein_1207 | DDE-type integrase/transposase/recombinase | - |
EL127_RS06245 | 1279487..1279846 | - | 360 | WP_001513660.1 | hypothetical protein | - |
EL127_RS06250 | 1279874..1280053 | - | 180 | WP_001513661.1 | hypothetical protein | - |
EL127_RS06255 | 1280058..1280438 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
EL127_RS06260 | 1280438..1280659 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL127_RS06265 | 1280842..1282398 | + | 1557 | WP_032265507.1 | type I restriction-modification system subunit M | - |
EL127_RS06270 | 1282395..1283657 | + | 1263 | WP_032265504.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1194378..1386043 | 191665 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T287265 WP_001216034.1 NZ_LR134236:c1280438-1280058 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |