Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 1280058..1280659 Replicon chromosome
Accession NZ_LR134236
Organism Escherichia coli strain NCTC9008

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag EL127_RS06255 Protein ID WP_001216034.1
Coordinates 1280058..1280438 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag EL127_RS06260 Protein ID WP_001190712.1
Coordinates 1280438..1280659 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL127_RS06220 1275109..1276041 - 933 WP_000081352.1 homocysteine S-methyltransferase -
EL127_RS06225 1276028..1277431 - 1404 WP_001373486.1 S-methylmethionine permease -
EL127_RS06230 1277675..1278655 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
EL127_RS06235 1278883..1279200 + 318 WP_001513659.1 hypothetical protein -
EL127_RS06240 1279150..1279563 - 414 Protein_1207 DDE-type integrase/transposase/recombinase -
EL127_RS06245 1279487..1279846 - 360 WP_001513660.1 hypothetical protein -
EL127_RS06250 1279874..1280053 - 180 WP_001513661.1 hypothetical protein -
EL127_RS06255 1280058..1280438 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL127_RS06260 1280438..1280659 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL127_RS06265 1280842..1282398 + 1557 WP_032265507.1 type I restriction-modification system subunit M -
EL127_RS06270 1282395..1283657 + 1263 WP_032265504.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1194378..1386043 191665


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T287265 WP_001216034.1 NZ_LR134236:c1280438-1280058 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT287265 WP_001190712.1 NZ_LR134236:c1280659-1280438 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References