Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3429352..3430009 | Replicon | chromosome |
Accession | NZ_LR134235 | ||
Organism | Klebsiella variicola strain NCTC9668 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | EL159_RS17120 | Protein ID | WP_002916310.1 |
Coordinates | 3429599..3430009 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | EL159_RS17115 | Protein ID | WP_002916312.1 |
Coordinates | 3429352..3429618 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL159_RS17095 | 3425795..3426523 | - | 729 | WP_012967245.1 | MurR/RpiR family transcriptional regulator | - |
EL159_RS17100 | 3426574..3426885 | + | 312 | WP_008806430.1 | N(4)-acetylcytidine aminohydrolase | - |
EL159_RS17105 | 3427049..3427708 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
EL159_RS17110 | 3428123..3429106 | - | 984 | WP_012967246.1 | tRNA-modifying protein YgfZ | - |
EL159_RS17115 | 3429352..3429618 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
EL159_RS17120 | 3429599..3430009 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
EL159_RS17125 | 3430016..3430537 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
EL159_RS17130 | 3430638..3431534 | + | 897 | WP_008806426.1 | site-specific tyrosine recombinase XerD | - |
EL159_RS17135 | 3431557..3432270 | + | 714 | WP_064166672.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL159_RS17140 | 3432276..3434009 | + | 1734 | WP_064166671.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T287254 WP_002916310.1 NZ_LR134235:3429599-3430009 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |