Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2966651..2967237 Replicon chromosome
Accession NZ_LR134235
Organism Klebsiella variicola strain NCTC9668

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag EL159_RS14680 Protein ID WP_002920800.1
Coordinates 2966869..2967237 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag EL159_RS14675 Protein ID WP_023298302.1
Coordinates 2966651..2966872 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL159_RS14655 2962800..2963726 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EL159_RS14660 2963723..2965000 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
EL159_RS14665 2964997..2965764 + 768 WP_008806972.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EL159_RS14670 2965766..2966479 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EL159_RS14675 2966651..2966872 + 222 WP_023298302.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL159_RS14680 2966869..2967237 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL159_RS14685 2967529..2968845 + 1317 WP_022066271.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EL159_RS14690 2968947..2969834 + 888 WP_110209735.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EL159_RS14695 2969831..2970676 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EL159_RS14700 2970678..2971748 + 1071 WP_008806977.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2963723..2972485 8762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T287252 WP_002920800.1 NZ_LR134235:2966869-2967237 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8123.14 Da        Isoelectric Point: 4.7769

>AT287252 WP_023298302.1 NZ_LR134235:2966651-2966872 [Klebsiella variicola]
MKTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure

References