Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2966651..2967237 | Replicon | chromosome |
| Accession | NZ_LR134235 | ||
| Organism | Klebsiella variicola strain NCTC9668 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | EL159_RS14680 | Protein ID | WP_002920800.1 |
| Coordinates | 2966869..2967237 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | EL159_RS14675 | Protein ID | WP_023298302.1 |
| Coordinates | 2966651..2966872 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL159_RS14655 | 2962800..2963726 | + | 927 | WP_012540389.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| EL159_RS14660 | 2963723..2965000 | + | 1278 | WP_008806971.1 | branched chain amino acid ABC transporter permease LivM | - |
| EL159_RS14665 | 2964997..2965764 | + | 768 | WP_008806972.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| EL159_RS14670 | 2965766..2966479 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| EL159_RS14675 | 2966651..2966872 | + | 222 | WP_023298302.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| EL159_RS14680 | 2966869..2967237 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| EL159_RS14685 | 2967529..2968845 | + | 1317 | WP_022066271.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| EL159_RS14690 | 2968947..2969834 | + | 888 | WP_110209735.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| EL159_RS14695 | 2969831..2970676 | + | 846 | WP_008806976.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| EL159_RS14700 | 2970678..2971748 | + | 1071 | WP_008806977.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2963723..2972485 | 8762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T287252 WP_002920800.1 NZ_LR134235:2966869-2967237 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|