Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1337970..1338589 Replicon chromosome
Accession NZ_LR134235
Organism Klebsiella variicola strain NCTC9668

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag EL159_RS06845 Protein ID WP_002892050.1
Coordinates 1338371..1338589 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag EL159_RS06840 Protein ID WP_008805436.1
Coordinates 1337970..1338344 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL159_RS06825 1333125..1334318 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
EL159_RS06830 1334341..1337487 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit -
EL159_RS06840 1337970..1338344 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
EL159_RS06845 1338371..1338589 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
EL159_RS06850 1338748..1339314 + 567 WP_022066286.1 maltose O-acetyltransferase -
EL159_RS28760 1339286..1339411 - 126 Protein_1290 hypothetical protein -
EL159_RS06855 1339451..1339921 + 471 WP_008805434.1 YlaC family protein -
EL159_RS06860 1339890..1341347 - 1458 WP_008805433.1 PLP-dependent aminotransferase family protein -
EL159_RS06865 1341448..1342146 + 699 WP_023297138.1 GNAT family N-acetyltransferase -
EL159_RS06870 1342143..1342283 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
EL159_RS06875 1342283..1342547 - 265 Protein_1295 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T287249 WP_002892050.1 NZ_LR134235:1338371-1338589 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT287249 WP_008805436.1 NZ_LR134235:1337970-1338344 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References