Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1337970..1338589 | Replicon | chromosome |
| Accession | NZ_LR134235 | ||
| Organism | Klebsiella variicola strain NCTC9668 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | EL159_RS06845 | Protein ID | WP_002892050.1 |
| Coordinates | 1338371..1338589 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1F2MBN7 |
| Locus tag | EL159_RS06840 | Protein ID | WP_008805436.1 |
| Coordinates | 1337970..1338344 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL159_RS06825 | 1333125..1334318 | + | 1194 | WP_012542667.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL159_RS06830 | 1334341..1337487 | + | 3147 | WP_008805437.1 | multidrug efflux RND transporter permease subunit | - |
| EL159_RS06840 | 1337970..1338344 | + | 375 | WP_008805436.1 | Hha toxicity modulator TomB | Antitoxin |
| EL159_RS06845 | 1338371..1338589 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
| EL159_RS06850 | 1338748..1339314 | + | 567 | WP_022066286.1 | maltose O-acetyltransferase | - |
| EL159_RS28760 | 1339286..1339411 | - | 126 | Protein_1290 | hypothetical protein | - |
| EL159_RS06855 | 1339451..1339921 | + | 471 | WP_008805434.1 | YlaC family protein | - |
| EL159_RS06860 | 1339890..1341347 | - | 1458 | WP_008805433.1 | PLP-dependent aminotransferase family protein | - |
| EL159_RS06865 | 1341448..1342146 | + | 699 | WP_023297138.1 | GNAT family N-acetyltransferase | - |
| EL159_RS06870 | 1342143..1342283 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| EL159_RS06875 | 1342283..1342547 | - | 265 | Protein_1295 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T287249 WP_002892050.1 NZ_LR134235:1338371-1338589 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14384.06 Da Isoelectric Point: 4.8989
>AT287249 WP_008805436.1 NZ_LR134235:1337970-1338344 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2MBN7 |