Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 3794027..3794622 | Replicon | chromosome |
| Accession | NZ_LR134234 | ||
| Organism | Escherichia coli strain NCTC8623 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | EL131_RS18665 | Protein ID | WP_000239579.1 |
| Coordinates | 3794272..3794622 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | EL131_RS18660 | Protein ID | WP_001223208.1 |
| Coordinates | 3794027..3794278 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL131_RS18650 | 3789692..3793471 | + | 3780 | WP_126510116.1 | autotransporter assembly complex protein TamB | - |
| EL131_RS18655 | 3793474..3793815 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| EL131_RS18660 | 3794027..3794278 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| EL131_RS18665 | 3794272..3794622 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| EL131_RS18670 | 3794702..3795232 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| EL131_RS18675 | 3795542..3796498 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| EL131_RS18680 | 3796808..3798310 | + | 1503 | WP_000205791.1 | sugar ABC transporter ATP-binding protein | - |
| EL131_RS18685 | 3798324..3799346 | + | 1023 | WP_001355798.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T287243 WP_000239579.1 NZ_LR134234:3794272-3794622 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |