Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2882334..2883134 | Replicon | chromosome |
Accession | NZ_LR134234 | ||
Organism | Escherichia coli strain NCTC8623 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4NNI0 |
Locus tag | EL131_RS14305 | Protein ID | WP_000342449.1 |
Coordinates | 2882334..2882861 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | EL131_RS14310 | Protein ID | WP_001277108.1 |
Coordinates | 2882868..2883134 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL131_RS14280 | 2877409..2878176 | - | 768 | WP_000082110.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
EL131_RS14285 | 2878173..2879450 | - | 1278 | WP_000803798.1 | branched chain amino acid ABC transporter permease LivM | - |
EL131_RS14290 | 2879447..2880373 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
EL131_RS14295 | 2880421..2881530 | - | 1110 | WP_001352761.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
EL131_RS14300 | 2881954..2882337 | + | 384 | WP_000778781.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
EL131_RS14305 | 2882334..2882861 | - | 528 | WP_000342449.1 | GNAT family N-acetyltransferase | Toxin |
EL131_RS14310 | 2882868..2883134 | - | 267 | WP_001277108.1 | DUF1778 domain-containing protein | Antitoxin |
EL131_RS14315 | 2883284..2884387 | - | 1104 | WP_001350438.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
EL131_RS14320 | 2884659..2885513 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
EL131_RS14325 | 2885758..2886816 | - | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
EL131_RS14330 | 2886809..2887477 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T287240 WP_000342449.1 NZ_LR134234:c2882861-2882334 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6GTS | |
PDB | 6AJN | |
PDB | 6GTQ | |
PDB | 6GTO | |
PDB | 6GTR | |
PDB | 6AJM | |
AlphaFold DB | A0A829CN24 |