Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3952817..3953649 Replicon chromosome
Accession NZ_LR134231
Organism Escherichia coli strain NCTC9087

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag EL105_RS19210 Protein ID WP_000854753.1
Coordinates 3952817..3953191 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID V0ULY5
Locus tag EL105_RS19215 Protein ID WP_001315620.1
Coordinates 3953281..3953649 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL105_RS19165 3948032..3949138 + 1107 WP_001341302.1 N-acetylneuraminate epimerase -
EL105_RS19170 3949203..3950183 + 981 WP_000991415.1 9-O-acetyl-N-acetylneuraminic acid deacetylase -
EL105_RS19175 3950191..3950841 - 651 WP_001037966.1 HNH endonuclease -
EL105_RS22365 3951886..3952038 - 153 WP_001280445.1 hypothetical protein -
EL105_RS19200 3952123..3952320 - 198 WP_000839281.1 DUF957 domain-containing protein -
EL105_RS19205 3952332..3952820 - 489 WP_000777547.1 hypothetical protein -
EL105_RS19210 3952817..3953191 - 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
EL105_RS19215 3953281..3953649 - 369 WP_001315620.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL105_RS19220 3953812..3954033 - 222 WP_000692345.1 DUF987 domain-containing protein -
EL105_RS19225 3954096..3954572 - 477 WP_001186774.1 RadC family protein -
EL105_RS19230 3954588..3954758 - 171 Protein_3738 antirestriction protein -
EL105_RS19235 3954743..3956278 - 1536 WP_000939409.1 hypothetical protein -
EL105_RS22440 3956399..3956605 - 207 Protein_3740 autotransporter adhesin family protein -
EL105_RS19250 3957353..3957478 + 126 Protein_3741 hemolysin activation protein -
EL105_RS19255 3957687..3957887 - 201 WP_000823256.1 hypothetical protein -
EL105_RS19260 3958169..3958300 + 132 Protein_3743 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimH / fimG / fimF / fimD / fimC / fimI / fimA / fimE / fimB 3931617..3978720 47103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T287223 WP_000854753.1 NZ_LR134231:c3953191-3952817 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13474.20 Da        Isoelectric Point: 6.2050

>AT287223 WP_001315620.1 NZ_LR134231:c3953649-3953281 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB V0ULY5

References