Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4265064..4265862 Replicon chromosome
Accession NZ_LR134228
Organism Escherichia coli strain NCTC9699

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag EL118_RS20710 Protein ID WP_000854919.1
Coordinates 4265064..4265441 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag EL118_RS20715 Protein ID WP_047088564.1
Coordinates 4265488..4265862 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL118_RS20665 4260260..4261366 + 1107 WP_001355522.1 N-acetylneuraminate epimerase -
EL118_RS20670 4261431..4262411 + 981 WP_000338801.1 9-O-acetyl-N-acetylneuraminic acid deacetylase -
EL118_RS20675 4262419..4263069 - 651 WP_001037977.1 HNH endonuclease -
EL118_RS24175 4264131..4264277 - 147 WP_001290177.1 hypothetical protein -
EL118_RS20700 4264362..4264559 - 198 WP_001327226.1 DUF957 domain-containing protein -
EL118_RS20705 4264579..4265067 - 489 WP_000777664.1 hypothetical protein -
EL118_RS20710 4265064..4265441 - 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
EL118_RS20715 4265488..4265862 - 375 WP_047088564.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL118_RS20720 4265942..4266163 - 222 Protein_4019 DUF987 domain-containing protein -
EL118_RS20725 4266250..4266726 - 477 WP_001186188.1 RadC family protein -
EL118_RS20730 4266741..4267220 - 480 WP_000706980.1 antirestriction protein -
EL118_RS20735 4267486..4268304 - 819 WP_001175165.1 DUF945 domain-containing protein -
EL118_RS20740 4268394..4268627 - 234 WP_001278293.1 DUF905 family protein -
EL118_RS20745 4268633..4269310 - 678 WP_001097302.1 hypothetical protein -
EL118_RS20750 4269458..4270138 - 681 WP_001282922.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimE / fimB 4256392..4281923 25531


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T287206 WP_000854919.1 NZ_LR134228:c4265441-4265064 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13600.33 Da        Isoelectric Point: 5.5051

>AT287206 WP_047088564.1 NZ_LR134228:c4265862-4265488 [Escherichia coli]
VSDTLSGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure

References