Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2913809..2914335 | Replicon | chromosome |
Accession | NZ_LR134228 | ||
Organism | Escherichia coli strain NCTC9699 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | EL118_RS14270 | Protein ID | WP_000323025.1 |
Coordinates | 2913809..2914096 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | EL118_RS14275 | Protein ID | WP_000534858.1 |
Coordinates | 2914096..2914335 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL118_RS14210 | 2908979..2909329 | - | 351 | WP_000193289.1 | YdfR family protein | - |
EL118_RS14215 | 2909334..2909549 | - | 216 | WP_000839572.1 | class II holin family protein | - |
EL118_RS14240 | 2910362..2911051 | - | 690 | WP_001064896.1 | antiterminator | - |
EL118_RS14245 | 2911048..2911413 | - | 366 | WP_000139992.1 | RusA family crossover junction endodeoxyribonuclease | - |
EL118_RS14250 | 2911414..2912469 | - | 1056 | WP_024188444.1 | DUF968 domain-containing protein | - |
EL118_RS14255 | 2912471..2912749 | - | 279 | WP_024175747.1 | hypothetical protein | - |
EL118_RS14260 | 2913046..2913438 | - | 393 | WP_000737636.1 | hypothetical protein | - |
EL118_RS14265 | 2913582..2913737 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
EL118_RS14270 | 2913809..2914096 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
EL118_RS14275 | 2914096..2914335 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
EL118_RS14280 | 2914360..2914665 | + | 306 | WP_001326990.1 | hypothetical protein | - |
EL118_RS14285 | 2914868..2915200 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
EL118_RS14290 | 2915637..2916977 | - | 1341 | WP_000589012.1 | ISNCY family transposase | - |
EL118_RS14305 | 2917678..2918487 | + | 810 | WP_126509240.1 | chaperonin | - |
EL118_RS14310 | 2918634..2919056 | - | 423 | WP_001151221.1 | DUF977 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2886581..2935011 | 48430 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T287202 WP_000323025.1 NZ_LR134228:c2914096-2913809 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|