Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2542354..2542992 | Replicon | chromosome |
Accession | NZ_LR134228 | ||
Organism | Escherichia coli strain NCTC9699 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EL118_RS12350 | Protein ID | WP_000813794.1 |
Coordinates | 2542816..2542992 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL118_RS12345 | Protein ID | WP_001270286.1 |
Coordinates | 2542354..2542770 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL118_RS12325 | 2537506..2538447 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
EL118_RS12330 | 2538448..2539461 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
EL118_RS12335 | 2539479..2540624 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
EL118_RS12340 | 2540869..2542275 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
EL118_RS12345 | 2542354..2542770 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL118_RS12350 | 2542816..2542992 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL118_RS12355 | 2543214..2543444 | + | 231 | WP_000494244.1 | YncJ family protein | - |
EL118_RS12360 | 2543536..2545497 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL118_RS12365 | 2545570..2546106 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
EL118_RS12370 | 2546159..2547373 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2542354..2559443 | 17089 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287201 WP_000813794.1 NZ_LR134228:c2542992-2542816 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287201 WP_001270286.1 NZ_LR134228:c2542770-2542354 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|