Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1386658..1387283 | Replicon | chromosome |
Accession | NZ_LR134228 | ||
Organism | Escherichia coli strain NCTC9699 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL118_RS06745 | Protein ID | WP_000911330.1 |
Coordinates | 1386885..1387283 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | EL118_RS06740 | Protein ID | WP_000450524.1 |
Coordinates | 1386658..1386885 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL118_RS06715 | 1382460..1382930 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
EL118_RS06720 | 1382930..1383502 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
EL118_RS06725 | 1383648..1384526 | + | 879 | WP_001311023.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
EL118_RS06730 | 1384543..1385577 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
EL118_RS06735 | 1385790..1386503 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
EL118_RS06740 | 1386658..1386885 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
EL118_RS06745 | 1386885..1387283 | + | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
EL118_RS06750 | 1387430..1388293 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
EL118_RS06755 | 1388308..1390323 | + | 2016 | WP_000829336.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
EL118_RS06760 | 1390397..1391095 | + | 699 | WP_000679812.1 | esterase | - |
EL118_RS06765 | 1391205..1391405 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T287193 WP_000911330.1 NZ_LR134228:1386885-1387283 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|