Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 49114..49946 | Replicon | chromosome |
| Accession | NZ_LR134228 | ||
| Organism | Escherichia coli strain NCTC9699 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | EL118_RS00250 | Protein ID | WP_000854753.1 |
| Coordinates | 49114..49488 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q5I3J0 |
| Locus tag | EL118_RS00255 | Protein ID | WP_001280951.1 |
| Coordinates | 49578..49946 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL118_RS00220 | 44480..45403 | - | 924 | WP_097516854.1 | carboxylate/amino acid/amine transporter | - |
| EL118_RS00225 | 45514..46698 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| EL118_RS00235 | 47490..48335 | - | 846 | WP_001406222.1 | DUF4942 domain-containing protein | - |
| EL118_RS00240 | 48420..48617 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
| EL118_RS00245 | 48629..49117 | - | 489 | WP_001549830.1 | hypothetical protein | - |
| EL118_RS00250 | 49114..49488 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| EL118_RS00255 | 49578..49946 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL118_RS00260 | 50109..50330 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
| EL118_RS00265 | 50399..50875 | - | 477 | WP_001186724.1 | RadC family protein | - |
| EL118_RS00270 | 50891..51223 | - | 333 | Protein_53 | antirestriction protein | - |
| EL118_RS00275 | 51470..52590 | + | 1121 | WP_087451024.1 | IS3-like element ISSen4 family transposase | - |
| EL118_RS00280 | 53529..54524 | - | 996 | WP_000157595.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T287184 WP_000854753.1 NZ_LR134228:c49488-49114 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q5I3J0 |