Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3357594..3358212 | Replicon | chromosome |
Accession | NZ_LR134227 | ||
Organism | Escherichia coli strain NCTC9102 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | EL093_RS16460 | Protein ID | WP_001291435.1 |
Coordinates | 3357994..3358212 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | EL093_RS16455 | Protein ID | WP_000344800.1 |
Coordinates | 3357594..3357968 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL093_RS16445 | 3352683..3353876 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
EL093_RS16450 | 3353899..3357048 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
EL093_RS16455 | 3357594..3357968 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
EL093_RS16460 | 3357994..3358212 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
EL093_RS16465 | 3358384..3358935 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
EL093_RS16470 | 3359051..3359522 | + | 472 | Protein_3195 | YlaC family protein | - |
EL093_RS16475 | 3359686..3361236 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
EL093_RS16480 | 3361278..3361631 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
EL093_RS16485 | 3361975..3362202 | - | 228 | WP_024183738.1 | DUF2188 domain-containing protein | - |
EL093_RS16490 | 3362420..3363040 | - | 621 | WP_001267012.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T287177 WP_001291435.1 NZ_LR134227:3357994-3358212 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT287177 WP_000344800.1 NZ_LR134227:3357594-3357968 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |