Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2346402..2347040 | Replicon | chromosome |
Accession | NZ_LR134227 | ||
Organism | Escherichia coli strain NCTC9102 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EL093_RS11410 | Protein ID | WP_000813794.1 |
Coordinates | 2346864..2347040 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL093_RS11405 | Protein ID | WP_001270286.1 |
Coordinates | 2346402..2346818 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL093_RS11390 | 2342935..2343510 | - | 576 | Protein_2214 | ABC transporter ATP-binding protein | - |
EL093_RS11395 | 2343528..2344672 | - | 1145 | Protein_2215 | ABC transporter substrate-binding protein | - |
EL093_RS11400 | 2344917..2346323 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
EL093_RS11405 | 2346402..2346818 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL093_RS11410 | 2346864..2347040 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL093_RS11415 | 2347262..2347492 | + | 231 | WP_000494244.1 | YncJ family protein | - |
EL093_RS11420 | 2347584..2349545 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL093_RS11425 | 2349618..2350154 | - | 537 | WP_126323072.1 | DNA-binding transcriptional regulator SutR | - |
EL093_RS11430 | 2350207..2351421 | + | 1215 | WP_126323074.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287176 WP_000813794.1 NZ_LR134227:c2347040-2346864 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287176 WP_001270286.1 NZ_LR134227:c2346818-2346402 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|