Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 682888..683723 | Replicon | chromosome |
Accession | NZ_LR134227 | ||
Organism | Escherichia coli strain NCTC9102 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | EL093_RS03325 | Protein ID | WP_126322993.1 |
Coordinates | 683346..683723 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | EL093_RS03320 | Protein ID | WP_126323184.1 |
Coordinates | 682888..683256 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL093_RS03290 | 678397..679719 | + | 1323 | Protein_645 | autotransporter adhesin family protein | - |
EL093_RS03295 | 680188..680957 | + | 770 | Protein_646 | autotransporter adhesin family protein | - |
EL093_RS03300 | 680956..681450 | + | 495 | Protein_647 | DUF932 domain-containing protein | - |
EL093_RS03305 | 681542..682027 | + | 486 | WP_126322989.1 | antirestriction protein | - |
EL093_RS03310 | 682043..682519 | + | 477 | WP_126322991.1 | RadC family protein | - |
EL093_RS03315 | 682588..682809 | + | 222 | WP_089570377.1 | DUF987 domain-containing protein | - |
EL093_RS03320 | 682888..683256 | + | 369 | WP_126323184.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL093_RS03325 | 683346..683723 | + | 378 | WP_126322993.1 | TA system toxin CbtA family protein | Toxin |
EL093_RS03330 | 683720..684208 | + | 489 | WP_089616157.1 | hypothetical protein | - |
EL093_RS03335 | 684220..684417 | + | 198 | WP_126322995.1 | DUF957 domain-containing protein | - |
EL093_RS03340 | 684514..685359 | + | 846 | WP_126323185.1 | DUF4942 domain-containing protein | - |
EL093_RS03350 | 685659..686165 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
EL093_RS03355 | 686244..688086 | - | 1843 | Protein_657 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | rfaE | 656370..706623 | 50253 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14306.41 Da Isoelectric Point: 9.5914
>T287165 WP_126322993.1 NZ_LR134227:683346-683723 [Escherichia coli]
MKTLSDTHVRKASRCPCPVTIWQTLLTRLLDQHYGLTLNDTPFADKRVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKYQEAKR
MKTLSDTHVRKASRCPCPVTIWQTLLTRLLDQHYGLTLNDTPFADKRVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKYQEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|